KEGG   Kitasatospora setae: KSE_76010tHelp
Entry
KSE_76010t        CDS       T01648                                 

Definition
(GenBank) putative acyltransferase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
8697986..8699245
Genome map
AA seq 419 aa AA seqDB search
MSSTPPATPRAAAGAKPAALAKLPSLTGLRFFAALAVFFFHSTLSNSPIPPNAPINPFAD
KGLAGFLETAFSKSGYLGVSFFFVLSGFVLAWASRPGERVTAFWRRRMLKIFPNHLVVFA
ASIVLFAGAAVTGTAQWLPNMLLVHTFFPQPDINLSVNPPSWSLGSELLFYVLFPLLIIP
IRKIAGKALWAWSAVMVAGTVAVQLVSTYLVPATPKSAITPVSDLQFWFGYLFPPGRVFE
FALGILLARIVMSGKWPRQIGIGVSFALTAVGYGVALLVPFQYSFVVAMIIPVSALICSV
AAADVDGRRTRLRGPVMQLLGEISFGFYLVQGVTIFYLRSLLGAHTYSAPVALLVVIGFL
AASLLGGWLLFRFVEMPAMRRWSRSRRPATATLPAALPAQDTDQDTDRSARPVTAASRT
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgacgccccctgccaccccccgcgccgccgccggcgccaagcccgccgccctg
gccaaactgccctcactgaccggactgcggttcttcgcggcgctggcggtcttcttcttc
cactccaccctgagcaactccccgatcccgcccaacgcccccatcaaccccttcgccgac
aagggcctggccggcttcctggagaccgccttcagcaagtccggctacctcggagtgtcc
ttcttcttcgtcctcagcggattcgtcctcgcctgggcctcacgccccggcgagcgcgtc
accgccttctggcgccgccggatgctcaagatcttccccaaccacctggtcgtcttcgcc
gcctcgatcgtcctgttcgccggcgccgccgtcaccggcaccgcccagtggctgccgaac
atgctgctcgtccacaccttcttcccgcagccggacatcaacctcagcgtcaaccccccg
agctggtccctcggcagcgaactcctcttctacgtcctcttcccgctgctcatcatcccg
atccgcaagatcgccggtaaggcgctgtgggcctggtccgccgtcatggtcgccggcacg
gtcgccgtccagctcgtctccacctacctcgtccccgccaccccgaagtccgccatcacc
cccgtctccgacctgcagttctggttcggctacctcttcccgccgggccgcgtcttcgag
ttcgccctcggcatcctgctcgcccgcatcgtgatgagcggcaagtggccgcgccagata
ggcatcggcgtctccttcgcgctgaccgccgtcggctacggcgtcgccctcctggtcccc
ttccagtacagcttcgtcgtcgccatgatcatccccgtcagcgccctgatctgctccgtc
gccgcggccgacgtcgacggccgccgcacccggctgcgcggacccgtcatgcagctgctc
ggcgagatctccttcggcttctacctcgtccagggcgtcacgatcttctacctgcgctcc
ctgctcggcgcccacacctacagcgccccggtggccctcctcgtcgtcatcggcttcctc
gccgcgtccctgctgggcggctggctcctgttccgcttcgtcgagatgccggccatgcgc
cgctggagccgcagccgcaggcccgccaccgccacgctccccgccgcgctccccgcccag
gacaccgaccaggacaccgaccgcagcgcccgccccgtcaccgccgcgagccgcacctga

DBGET integrated database retrieval system