KEGG   Kitasatospora setae: KSE_76070tHelp
Entry
KSE_76070t        CDS       T01648                                 

Definition
(GenBank) putative DNA-binding protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
8704525..8705442
Genome map
AA seq 305 aa AA seqDB search
MDTPSVLGDFLRSRRARLQPEDVGLRAYGARRRVPGLRREELAQLAGVSVTHYTRLEQGQ
STNASDAVLDAIARALRLNTDETAHLRDLARPAAPARPAPLRPDYARPAAAQLIAAMTDV
PAVILDRRNDVLAWNPLGHALLAGHIDYTAPQSPSERPNLTRMLFLDEHTRELHTAWEDE
AKTSVAALRLTAGRHPDDRRLAELIGQLAMKSDEFAGMWSRHPVRSCTFGTKLLHHPFVG
ALELSFESMQLADDSGQRMLAYSAPAGSPSQAGLQLLAGTLLSHPPHGARPAARGHLAGE
KPRDR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacacaccatccgtgctgggagacttcctgcgcagccgacgagcccggctccaaccg
gaggacgtgggcctgcgggcctacggagcccgccgacgcgtcccgggactacgacgcgag
gagctcgcccaactggccggcgtgagcgtcacccactacacccgcctcgaacagggccag
agcaccaacgcctccgacgccgtcctcgacgcgatcgcccgcgcgctgcgcctgaacacc
gacgagaccgcgcacctgcgcgacctggcccgccccgccgcccccgcccgccccgccccg
ctgcgaccggactacgcccgccccgccgccgcccagctcatcgccgccatgaccgacgtg
cccgccgtcatcctcgaccgccgcaacgacgtcctggcctggaacccgctgggccacgca
ctcctcgccggccacatcgactacaccgccccccagtcgccctcggaacgccccaacctc
acccgcatgctcttcctcgacgagcacacccgcgaactccacaccgcctgggaggacgag
gccaagacatccgtcgcggcactgcgcctcaccgccggccgccaccccgacgaccgccgc
ctcgccgagctgatcggccagctcgcgatgaagagcgacgagttcgccgggatgtggtca
cgccacccggtccgcagctgcaccttcggcaccaagctgctgcaccaccccttcgtgggg
gcactggagctgtccttcgagagcatgcagctggcggacgactccgggcagcggatgctc
gcctacagcgcgccggccggatcgccctcgcaggccggactccagctcctggccggaacc
ctgctgagccacccgccgcacggcgcccgccccgccgcccgcggacacctcgccggcgag
aagccccgcgacaggtag

DBGET integrated database retrieval system