KEGG   Kitasatospora setae: KSE_76330tHelp
Entry
KSE_76330t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(8731031..8731996)
Genome map
AA seq 321 aa AA seqDB search
MAYGPEAAAVVLAAAGAGAMGAMLPPNLAVALLLGTLVLSYRQVIAVHPGGGGSYAVAKQ
EFGRTTALLAAAGLVVDYVLTAAVSLATGAASLASAFPVLNDHLPLVALTGLAVLTAVNL
RGLADSARLLAPLTLLFVLAVLAVVVLGAARPHPVGAVGGPPTVAVTQGLGVLLVLKAFA
AGCTAVSGVEAIANGVPAFRPPRVRTARRTQVLLGVLLAVMLVGLGHLMARDHVVPRADV
TVLAQLTAHSLGTGWPYYATNLTVALLLAAAANTSFGSLPILLALLARDDRLPTSSRSAR
PGRSTAPACWAWPSSPRSCSW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggcctacgggcccgaggcggcggcggtggtcctggcggcggccggcgcgggcgcgatg
ggcgcgatgctgccgccgaacctcgccgtcgcgctgctgctgggcaccctggtgctctcc
taccggcaggtgatcgccgtgcatcccggcgggggcggctcgtacgcggtggccaaacag
gagttcggccgcaccaccgcgctgctcgcggcagccggcctggtggtcgactacgtcctc
accgccgccgtcagcctggccaccggcgccgccagcctcgcctccgccttccccgtcctc
aacgaccacctgcccctggtggcgctgaccgggctggccgtcctcacggccgtcaacctg
cgcggactcgccgacagcgcacgcctgttggcgccgttgacgctgctcttcgtcctcgcg
gtgctggccgtcgtcgtcctgggcgccgcccgcccgcacccggtcggcgcggtcggcggc
ccgcccaccgtcgccgtcacgcagggcctgggcgtgctgctcgtgctcaaagccttcgcc
gccggctgcaccgcggtcagcggggtcgaggcgatagccaacggcgtccccgccttccgc
ccgccccgggtgcgcaccgcccggcgcacgcaggtgctgctcggcgtcctgctggcggtg
atgctggtcggcctgggccacctgatggcccgcgaccacgtcgtcccgcgggccgacgtc
accgtcctcgcccagctcacggcccactccctgggcaccggctggccctactacgccacc
aacctgaccgtcgccctgctgctggccgccgccgcgaacaccagcttcggctcgctgccg
atcctgctcgccctgctcgccagggacgaccggctccccacctcttcgcgctccgctcgg
cccggccggtccaccgcgccggcgtgctgggcctggccgtcctcaccgcgctcctgctcg
tggtga

DBGET integrated database retrieval system