KEGG   Kitasatospora setae: KSE_76370tHelp
Entry
KSE_76370t        CDS       T01648                                 

Definition
(GenBank) putative oxidoreductase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
8734265..8735779
Genome map
AA seq 504 aa AA seqDB search
MGSREPDTTETPGAGGRGGQAFDVVVVGNGVLGMSLAVVLLRRGARVAVVGDGNRPLAAS
TASGAMNGCFGEVTATTTATAHGRARLEMDVLAARLWDDWLAGLEEDGGATVRCARGTLV
IHNTIGMAEIDDTAMTAIRAALELHGEPFESVDPTEAVPWLDPQPTARPLAGLFLPREHG
VDSGALLKVLHRAVVRLGGVLVPEHAVRVVHGAGRAGGIALADGTVLAGDRVVLAAGVGT
QALMDSLPPEVSAPVPRLISGFGVSVVLSNGPAAAPPDCVVRTPNRSFGCGLHTVPRGPD
RVYVGATNTTRPRPGSDPSVRDLAFLLDCAARQLRRDLWFSDITATRVGNRPMTLDGHPL
LGETLLPGLWLMTGTFRDGLHTSPLLASRLADRILDGTPPTPEMDLFRPTRPPIQTMDRR
DTVRHATVHRLAVGHEWNWSLPVEWPVHLEEMYEAKYRAVAERTHDTITPPPEVLAYIPA
FPELADMLDAYYTASRPRLGASGD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgggaagtcgggaaccggacacgacggagacccccggggcgggcggccggggcgggcag
gcgttcgacgtggtggtggtcggcaacggggtgctggggatgtccctggcggtggtgctg
ctgcggcggggcgcgcgggtggcggtggtcggcgacgggaaccggccgctggccgcgtcg
acggcgtccggggcgatgaacgggtgcttcggcgaggtgaccgcgaccacgacggccacc
gcgcacgggcgggcccggctggagatggacgtgctcgcggcccgcctgtgggacgactgg
ctcgccggactggaggaggacggcggcgcaacggtccggtgcgcgcggggaacgctcgtc
atccacaacacgatcggcatggcggagatcgacgacaccgcgatgacggcgatccgcgcc
gcgctggagctccacggggagcccttcgagagcgtcgatcccaccgaggccgtcccctgg
ctcgatccgcagccgaccgcccggccgctggccggcctcttcctcccccgcgagcacgga
gtcgactccggcgcgctgctcaaggtcctgcaccgcgccgtcgtccggctgggaggcgtc
ctggtccccgagcacgccgtccgcgtcgtccacggcgcgggccgggccggcgggatcgcc
ctggccgacgggacggtgctggccggtgaccgggtggtgctggccgccggcgtcggcacc
caggcgctgatggactcgctgccccccgaggtcagcgcccccgtaccccggctgatcagc
gggttcggcgtgtcggtggtcctgtcgaacggcccggccgccgccccgccggactgcgtc
gtgcgcacccccaaccgctccttcggctgcgggctgcacaccgtgccgcgcggtcccgac
cgggtctacgtgggcgccaccaacaccacccggccccgcccgggcagcgaccccagcgtc
cgcgacctggcgttcctgctggactgcgccgcccggcaactgcgcagggacctgtggttc
agcgacatcaccgccaccagggtcgggaaccggccgatgaccctggacggccaccccctc
ctcggagagaccctcctgccggggctgtggctgatgaccggcacctttcgcgacggcctg
cacacctccccgctcctggcctcccggctggccgaccggatcctcgacggaacgccgccc
acaccggagatggacctcttccggccgacccggccaccgatccagaccatggaccgccgg
gacaccgtccgccacgccaccgtgcaccgcctggccgtcggccacgagtggaactggtcg
ctgcccgtcgaatggcccgtccacctcgaagagatgtacgaggccaagtaccgggccgtc
gccgagcggacccacgacaccatcaccccgccgccggaagtcctcgcctacatccccgcc
ttccccgagctcgccgacatgctcgacgcctactacaccgccagccggccccgcctgggc
gcctccggcgattga

DBGET integrated database retrieval system