KEGG   Kitasatospora setae: KSE_76540tHelp
Entry
KSE_76540t        CDS       T01648                                 

Definition
(GenBank) putative sesquiterpene cyclase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Structure
PDB: 

Jmol
Position
8750526..8751542
Genome map
AA seq 338 aa AA seqDB search
MAEFEIPDFYVPFPLECNPHLEEASRAMWEWIDANGLAPTERARDRMRRTGADLSGAYVW
PRADLDTLTIGLKWIALTFRIDDQIDEDDTAERLPARMTAIDELRGTLHGLPVSGRSPTA
RALGALWQETALGRPATWCDAFIGHFEAFLQTYTTEAGLNAHGAGLRLDDYLDRRMYSVG
MPWLWDLDELRLPIFLPGSVRTCGPMNKLRRAGALHIALVNDVFSVERETLVGYQHNAVT
IIREAQGCSLQEAVDQVAVLVEAQLHTVLQARQELLEELDRQALPSRAREAAVDYAANVA
ANLSGQLVWHSSVERYAVDDLQSAADPRATPTTSSLGI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcgagataccggacttctacgtccccttccccctggagtgcaatccgcac
ctggaggaggcgtcccgggcgatgtgggagtggatcgacgcaaacggcctcgcgcccaca
gaacgggcacgcgacaggatgcggcgcacgggagccgacctctcgggggcgtatgtgtgg
ccccgcgccgacctcgacacactgacgatcggtctgaaatggatcgcgctgaccttccgg
atcgacgaccagatcgacgaggacgacaccgcggagcggctgccggcccggatgacagcc
atcgacgagctgcgcggcaccctgcacggactcccggtctccgggcggtcaccgaccgcc
cgggccctgggcgccctgtggcaggagaccgccctcggacggcccgctacctggtgcgat
gccttcattgggcacttcgaggcgttcctccagacctacacaaccgaggccggcctcaac
gcccacggcgccggactccgcctcgacgactacctcgaccgcaggatgtactcggtcggc
atgccctggctttgggacctcgacgaactgcgccttccgatcttcctgcccggctccgta
cgaacctgcggcccgatgaacaaactgcgccgggccggcgcgctgcacatcgcgttggtg
aacgacgtcttctccgtcgaacgggagaccctcgtcgggtaccagcacaacgcggtcacc
atcatccgagaagcacagggctgctcgctgcaggaagcggtggaccaagtggcggtcctc
gtcgaagcccagctccacacggtgctgcaagcccggcaggaactcctcgaagaactcgac
aggcaagccctgccgtcacgggctcgcgaggccgcagtcgactacgcggccaacgtcgcc
gccaacctgagcgggcagctcgtttggcactcctcggtcgaacggtatgccgtcgacgac
ctccagtccgcggccgatccacgggctaccccgacgacctcctctctgggaatatag

DBGET integrated database retrieval system