KEGG   Kitasatospora setae: KSE_76560tHelp
Entry
KSE_76560t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(8752470..8752796)
Genome map
AA seq 108 aa AA seqDB search
MARVRYCASCGGRLPRGASSRRRYCDDACRAQAYRDRKAEQRRLDFLTLLGQAHYASHRR
LIRALTCPVCGRATMARASRRRDAVYCSGRCRSRAWRQRASRRARSAA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgtgtccggtactgcgcgagctgcggcggccggctcccccggggagcctcgtcc
cggcgccggtactgcgacgacgcctgccgggcccaggcgtaccgggaccgcaaggcggaa
cagcgccgcctggacttcctgaccctgctcgggcaggcccactacgccagtcaccgacgg
ctgatccgggcgctgacctgtccggtctgtgggcgcgcgaccatggccagggcgagccgg
cggcgcgatgccgtctactgctccggtcggtgccggtcccgcgcctggcgtcagcgggct
tcccgccgagcccggtcggcagcgtga

DBGET integrated database retrieval system