KEGG   Kitasatospora setae: KSE_76570tHelp
Entry
KSE_76570t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
8753345..8753836
Genome map
AA seq 163 aa AA seqDB search
MKTVSDFLPLLGAPVRQDEGHLIKEIAASWSITLPEDFIAIAGAYGDALISDYLYFCGAR
KLRSYADRMGRMLEATRTVPHAVLPTPGGALVWGNTVEGDQLFLVPRGDGSWTVSAFRRG
WADWHDTDLGFSDWFHLALTGQTATDWLPEWEPLPHPLEPSDE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgtcagcgatttcttgcccttgctcggggctcctgtccggcaggacgaaggg
catctgatcaaggagatcgctgcctcctggtcgatcaccttgcccgaggacttcatcgcg
atcgccggcgcgtacggcgacgcgctgatctcggactacctctacttctgcggggcccgg
aagctccgcagctacgccgaccgcatgggccgcatgctggaggcgacccggacggttccc
cacgcggtgctgccaaccccgggcggtgccctggtctgggggaacacggtcgaaggcgac
cagctgttcctcgttccccgcggggacgggtcctggacggtctcggcgttccgacgtggc
tgggcggactggcacgacactgacctcggcttcagcgactggttccaccttgcgctgacc
ggccagacggccaccgactggctgcccgagtgggagccacttccccacccccttgagccc
agcgacgagtga

DBGET integrated database retrieval system