KEGG   Kitasatospora setae: KSE_76640tHelp
Entry
KSE_76640t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TniQ DrsE HAD
Motif
Other DBs
NCBI-ProteinID: BAJ33415
NITE: KSE_76640t
UniProt: E4MYX0
Position
complement(8764933..8765949)
Genome map
AA seq 338 aa AA seqDB search
MNVQEHGRCSDLRELPLHVRFLPNESTGSYVTRLAERNGLSVGYLLEIVGEGKSRVVAPH
LTELYLNRPAAERLARLAGRPLPVLQRALASLGEEYLLTGSGEHPVWKWPWAVTDGYLVR
ACALCAARRGVTEPAWLMVPDTWSVCGEHARWTDNSRDTAWPWTDLRPWPQVLDAHRRLA
CLGRRMGKVGRALMADAFSMMADRQVRSLYGRAPRWFAEAADRLGERRAAPFLAYPEAVR
VARVLARSERHRLAGALTWEEYRRWHAQAVAELGPAFSPVLTVWMARHQPQTSVAARKAG
VRPPLAAPHKVVGALASVAQLSCLPGELGAGTFDRPYL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtgcaggagcatggccgctgttcggacctgcgggagctgccgctgcatgtgcgc
ttcctgccgaacgagtcgaccggttcgtacgtgacccggctcgccgagcgcaacgggctg
agtgtgggctacctgctggagatcgtgggtgagggcaagagccgggtggttgcgccccac
ctgaccgagctctacctcaaccggcccgcggccgagcgtctggcccggctcgccggccgg
cccctgcccgtgctgcaacgggccttggcgagtctgggcgaggagtacctactgacgggc
tccggggagcacccggtgtggaagtggccgtgggccgtgacggacggctacctggtacgg
gcgtgcgcgctgtgcgcggcccggcgcggggtcaccgagccggcgtggctgatggtgccc
gacacctggagcgtgtgcggcgagcatgcccggtggacggacaactcgcgcgacacggcg
tggccgtggaccgatctgcggccgtggccgcaggtccttgacgcccaccgccggttggcg
tgtctgggccggcggatgggaaaggtggggcgggcgctgatggcggacgccttctccatg
atggccgaccgccaggtgcggtccttgtacggacgggcgccgcgctggttcgccgaagcc
gcggaccggctcggggaacggcgggcggcaccgttcctggcgtatccggaggcggtccgg
gtcgcgcgggtcctggcgcgcagcgagcggcaccggctggcgggggcgttgacgtgggag
gagtaccggcgttggcacgcgcaggcggtggccgaactgggcccggcgttcagcccggtc
ctgaccgtctggatggcccggcatcagccgcagacgtccgtggcggcgcgcaaggcaggg
gtccggccgccgctggccgctccgcacaaggtggtcggcgcgctggcgtcggtggcgcaa
ctgagctgtctgccgggcgagctgggcgccggaaccttcgaccggccctacctgtga

DBGET integrated database retrieval system