KEGG   Kitasatospora setae: KSE_76700tHelp
Entry
KSE_76700t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(8775204..8777024)
Genome map
AA seq 606 aa AA seqDB search
MARQFSYEKLVLTSVNGVREVDLDHPVIGVFGPIDTGKTTLVDALAYPLGYSVDWRQVPK
DRLISVTVVLRVEGMRIALRRGLGSRANLVELIDPRSGEVDETLVVKYDPSGKQRRVGDV
LLELLGLAELFAPPEAVAVSSAGAGRLSFEHLYPLCYLSQDMVDGGELVRGGANSASSYK
AVVELLLHLTDARTRILTARLKVLLDAVRPLQARVEHVKEFLAAARDEHALRQDLEESRR
RVQETLVALEEFKGRQRAMTAEQDPLRCKVAEREAAAARCRSVAAEARAEVERMVGRVRG
LQHRAQAGPRLVSPCPGCARDLTGRTVGDGFCGVCTERWDASRLQDLLRLAETELLAAEQ
AATAATKEQGRKEADLAAAQAELDAHLASRIGPAAGHLEQLAAAHASAKAQSAALEQELE
PYARLRELQQELERAVGERDEVKQQLADHRASLSGRQVAVQEIEDFFRHIIDALQLPGDP
GAAIDRSSYLPRVRRGPLSNVGHGVRTVLNVAYRMAFTSHALVTGATDLPTLLVIDSPRK
NVGYGTDDQQLISRLYTHFLEHITAVREGTTVVRPSQVIIVDNDLPVGFRDRLHVIELSR
ENPLVP
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcagttctcctacgagaagttggtgctcacctcggtcaacggggtcagggag
gtggacctcgaccacccggtgatcggggtgttcggcccgatcgacaccggcaagaccacg
ttggtggatgcgttggcctatccgctcggttacagcgtcgattggcgccaggtccccaag
gatcggctgatctccgtcaccgtcgttctgcgggtcgagggcatgcgtatcgcgctgcgt
cggggtctgggtagtcgtgcgaatctggtcgagctgatcgatccgcgtagcggcgaggtc
gatgagactctcgtggtgaagtacgacccttccgggaagcagcgccgggtcggggacgtg
ctgttggagctgctggggttggcggagctgttcgccccgccggaggcggtggcggtgtcg
tcggcgggcgcggggcggttgtcgttcgagcacctgtacccgctgtgctacctgagccag
gacatggtcgacggcggtgagctggtgaggggtggggccaacagcgcgtcgtcgtacaag
gcggtggtggagttgctgctgcacctgacggatgcgcgcacgcggattctcaccgcccgg
ctcaaagtcctgctcgatgccgtacggccgctgcaggcccgggtcgagcacgtcaaggag
ttcctggcggcggcccgcgacgagcacgccctgcgtcaggatctggaggagagccggcga
cgcgtgcaggagacgctggtggcgttggaggagttcaaggggcgtcagcgggccatgacc
gccgagcaggatccgctgcggtgcaaggtcgccgagcgggaggcggccgcggcgcgctgc
cggtcggtggctgcggaggcccgggcggaggtggagcgcatggttggacgggttcggggt
ctgcagcaccgtgctcaggcggggccgcgcctggtcagcccgtgccctggctgtgcccgg
gacttgacggggcgtacggtcggggacgggttctgcggggtgtgtaccgagcggtgggac
gcctcgcggttgcaggatctgctccgccttgccgagaccgagcttctggctgccgagcag
gccgccaccgcggcgaccaaggagcaggggcggaaggaggccgacctggcggccgcccag
gccgagctggacgcccatctggcttcgcggatcggcccggccgcgggccacttggagcag
ctcgctgcggcgcatgcctcggcgaaggcccaaagtgccgcgctcgagcaggagctggag
ccctatgcccggctgcgggagttgcagcaggagctggagcgggcggtcggtgagcgcgac
gaggtcaagcagcaactcgccgaccatcgtgcgtctctgtcggggcgtcaggtggctgtg
caggagatcgaggacttcttccggcacatcatcgacgccctccagctgccgggtgacccg
ggagcggcgatcgaccgttccagctacctgccgagggtgcggcgcgggccgctgagcaat
gtcgggcacggggtgcggaccgtgctgaatgtcgcctaccggatggcgttcaccagccac
gcccttgtcaccggagccaccgacctgccgaccctgctcgtcatcgactcccctcgcaag
aacgtcggctacggcaccgacgaccagcagctcatcagccgcttgtacacccacttcctc
gaacacatcaccgctgtgcgcgagggcacaaccgtggtgcggccttcccaggtcatcatc
gtcgacaacgacctgcccgtcgggttccgggaccggctgcatgtcatcgagctcagccgt
gagaacccgctcgtgccgtaa

DBGET integrated database retrieval system