KEGG   Kurthia sp. 11kri321: ASO14_1650Help
Entry
ASO14_1650        CDS       T04250                                 

Gene name
acaa2
Definition
(GenBank) 3-ketoacyl-CoA thiolase, mitochondrial
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kur  Kurthia sp. 11kri321
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:kur00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASO14_1650 (acaa2)
   00630 Glyoxylate and dicarboxylate metabolism
    ASO14_1650 (acaa2)
   00640 Propanoate metabolism
    ASO14_1650 (acaa2)
   00650 Butanoate metabolism
    ASO14_1650 (acaa2)
  Lipid metabolism
   00071 Fatty acid degradation
    ASO14_1650 (acaa2)
   00072 Synthesis and degradation of ketone bodies
    ASO14_1650 (acaa2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASO14_1650 (acaa2)
   00310 Lysine degradation
    ASO14_1650 (acaa2)
   00380 Tryptophan metabolism
    ASO14_1650 (acaa2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASO14_1650 (acaa2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ASO14_1650 (acaa2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ASO14_1650 (acaa2)
Enzymes [BR:kur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ASO14_1650 (acaa2)
Exosome [BR:kur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASO14_1650 (acaa2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1577727..1578908)
Genome map
AA seq 393 aa AA seqDB search
MEDVYLIEGARTAFTAFTGSFATVSAIQLGTVTAVEALNRSKVAPEDVDAVFYGNVIATG
KDAAYTARHIALLAGLPEEIPALTLNRLCGSGLQSVISGAQEIQLGESQIVLAGGTENMS
QAPFSNFEQRSQSSKMGNIQFEDMLQATLTDQYTGMGMGMTAENLAEKYAITREQQDAYA
VLSHERAAASQQADVFAREIVPVQVPTRKGTRVIEQDEQIRPDTTVEQMAQLQPVFKRQG
TVTAANASSINDGAASIVLASGQAVEEKGLQPLAKIISYAAVGVDPNYMGIGPVPAIKRA
LVRANLTIDDIDLFEINEAFAAQYLAVEQELQLDRNRVNVHGGAIALGHPVGASGTRVLL
SAAHTLHERQERYAVVSLCIGGGQGIAMIIERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgtgtatctaattgaaggtgcgcgaacagcctttactgcgtttacaggctct
tttgcgaccgtatcagccattcaactcggaacggtaacagctgttgaagcattgaatcgc
tcgaaagttgcaccagaagatgttgatgctgtattttacgggaatgtcattgcgacaggt
aaagatgcagcttatacagcgcgtcatattgcgttacttgcaggattaccagaagaaata
cctgctctcacattgaatcgattatgtggttcaggattacaatctgttatttcaggcgca
caggagattcaacttggtgaatcacaaatcgttttagcaggtggcacagaaaatatgtca
caagctccattttcaaattttgaacagcgcagtcaatcatcaaaaatggggaatattcaa
tttgaagatatgctacaagctactttaaccgatcaatacacaggcatgggtatgggcatg
acagctgaaaatttagctgaaaaatatgcgattacgcgagaacaacaagatgcctatgcg
gtattatcacatgaacgtgcagcagcctcacaacaagcagatgtattcgcacgtgagatt
gtgcctgttcaagtgccaacacgtaaaggaacacgcgtaattgagcaagatgaacaaatt
cgtccagatacaaccgttgaacagatggcacagctccaacctgttttcaaacgccaaggt
actgttacagcagcaaacgcctcaagtattaatgacggtgcagcttcaatcgtacttgca
agtgggcaagctgtagaagaaaaaggattacaaccactcgcaaaaatcatttcgtatgct
gctgttggcgtggatccgaactacatgggaattggtcctgtacccgcgattaaacgcgct
ttagtacgtgcaaatttaacaatagatgatattgacttatttgagattaatgaagctttt
gcagcacaatatttagcagttgaacaagagctacaactagaccgtaatcgtgtgaatgta
catggaggagcaattgcacttgggcatcctgttggtgcaagtggtacacgtgtattattg
agtgcagcacatacattgcatgaaagacaggaacgctatgcagttgtaagcctttgcatt
ggcggaggtcaaggaattgcgatgattattgagcgcgtatag

DBGET integrated database retrieval system