KEGG   Kurthia sp. 11kri321: ASO14_2936Help
Entry
ASO14_2936        CDS       T04250                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kur  Kurthia sp. 11kri321
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:kur00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASO14_2936
   00630 Glyoxylate and dicarboxylate metabolism
    ASO14_2936
   00640 Propanoate metabolism
    ASO14_2936
   00650 Butanoate metabolism
    ASO14_2936
  Lipid metabolism
   00071 Fatty acid degradation
    ASO14_2936
   00072 Synthesis and degradation of ketone bodies
    ASO14_2936
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASO14_2936
   00310 Lysine degradation
    ASO14_2936
   00380 Tryptophan metabolism
    ASO14_2936
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASO14_2936
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ASO14_2936
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ASO14_2936
Enzymes [BR:kur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ASO14_2936
Exosome [BR:kur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASO14_2936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2900596..2901687
Genome map
AA seq 363 aa AA seqDB search
MFNVVILKAKRTPIGKVNGQFKHIPPQQLMTPILRSLVEGLTVPIDDVILGNVVGPGGNV
ARFSVLEAGLPMEIPGMTIDRQCSAGLEAIRLASYFIKSGAGQCYIAGGVESASTSPFSK
RAQFSPKEIGDPDMVEAAENVARKFYVSKEQQDTYALTSYERTWRAFESEYLQQEIIPIQ
QLQCDEELYKKRDLAILLKRIRPLLKDGTVTAANSCGIHDGASAVLIMEEELAIQQGFQP
VLRFIDSVVVGNHPNYPGAAPIPAIQQLLKKQQLTVEQIDLFEINEAFASKIVACMQELN
IPLEKINCGGGALTIGHPYGASGSILITRLFYEVQRRENLKYVVAAIGSGGGIGVAVLFE
VVV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatgtggtaattttgaaagctaaacgaacgccaattggaaaagtaaatggacaa
tttaaacatataccgccacaacaattgatgacacctattttaagaagtttagtagaaggt
ttaacagtgccaattgacgatgttatcttaggaaatgttgtagggcctggtggaaatgta
gcgcgattttccgtattggaagcgggtttaccgatggaaatccctggcatgacaattgac
cgtcaatgcagtgcagggttagaagccattagactggcaagttactttataaagtccgga
gcaggacaatgttatattgctggtggggttgaaagtgctagtacatcacccttttctaaa
agagcacaattttcaccaaaagaaataggcgatccagatatggttgaagcagctgaaaat
gtagcgcgaaagttttatgtttcaaaagaacagcaagatacttatgctttaacgagttat
gaaagaacatggcgagcgtttgagagtgaatatttacaacaagaaattataccgattcag
cagttacaatgtgatgaagaattatataagaaaagggatttagctattttactcaaaaga
atacgtccacttttaaaagatggaactgtaacagcagctaatagttgtggtattcatgat
ggtgcttcagcagtattgattatggaagaagaattagcaattcaacaaggatttcaacca
gtcctacgttttattgatagtgtcgtagttggaaatcatccgaattatcctggagctgca
ccgattccagcaattcaacagcttttaaaaaagcaacaactaacagtagaacaaattgac
ttatttgagataaatgaagcttttgcatctaaaatagtggcatgtatgcaagagttgaat
attccacttgaaaaaataaactgcggaggaggggcactaaccattggacatccttacggt
gcgtcagggagtattctaatcacgcgtttattttatgaagtacaaagacgggaaaatcta
aagtatgtagtagcagcaatcggtagtggtggtgggattggtgtagctgtcttatttgag
gtagttgtatga

DBGET integrated database retrieval system