KEGG   Klebsiella variicola At-22: Kvar_0096Help
Entry
Kvar_0096         CDS       T01170                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00010  Glycolysis / Gluconeogenesis
kva00051  Fructose and mannose metabolism
kva00562  Inositol phosphate metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
kva01230  Biosynthesis of amino acids
Module
kva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kva_M00002  Glycolysis, core module involving three-carbon compounds
kva_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_0096
   00051 Fructose and mannose metabolism
    Kvar_0096
   00562 Inositol phosphate metabolism
    Kvar_0096
Enzymes [BR:kva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kvar_0096
Exosome [BR:kva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kvar_0096
  Exosomal proteins of bladder cancer cells
   Kvar_0096
  Exosomal proteins of melanoma cells
   Kvar_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: ADC56028
JGI: Kvar_0096
Position
complement(99556..100323)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaccgaactggctggcgtaagcggctgtgcagttgccatc
gccccgccggaaatgtatctggacctggctaaacgtgcggcagaaggcagccacattcac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcacagtacatcatcatcggccactccgagcgtcgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgctgtgctgaaagagcagggt
ctgaccccggtactgtgcatcggtgaaaccgaagccgaaaacgaagcgggcaaaaccgaa
gaagtttgcgcacgtcagatcgacgccgtgctgaaaacgcagggcgctgccgctttcgaa
ggcgtggttatcgcttacgaaccggtatgggctatcggtaccggcaaatccgcgaccccg
gctcaggctcaggcggtgcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgagcaagtgatcatccagtacggtggttccgttaacgctggcaacgcagcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcctccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcagcgaaaaaagcgtaa

DBGET integrated database retrieval system