KEGG   Klebsiella variicola: Kvar_0174Help
Entry
Kvar_0174         CDS       T01170                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kva  Klebsiella variicola
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:kva00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kva00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
180880..182202
Genome map
AA seq 440 aa AA seqDB search
MQTYFDQLDRVRYEGPKSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGSFDRPWQQPGDALEMAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYSNNFA
RMVEVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFKGTLLIEPKPQEPTK
HQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAARMIEDGELDKRVARRYAGWNGELGQQILNGQMTLSDIAQYATQHQLAPQ
HRSGQQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctatttcgatcaactcgatcgcgttcgttacgaaggcccgaaatccactaac
ccgctggctttccgtcactacaacccggatgaactggtgctgggcaaacggatggaagat
catctgcgttttgcggcctgttactggcataccttctgctggaatggcgccgatatgttt
ggcgtgggctcctttgaccgtccatggcagcagcctggcgacgccctggagatggccaaa
cgtaaagccgatgtggcgtttgaattcttccacaaactcaacgtgccttactactgcttc
cacgacgttgacgtctcgccggaaggcgcttcgctcaaggagtacagcaataacttcgcc
cggatggtcgaggtgctggcagagaaacagcagcagagcggcgtgaagcttttgtggggg
accgcaaactgttttaccaacccgcgctacggcgctggcgcggccaccaacccggatccg
gaagtgtttagctgggcggccacccaggtggtcaccgccatgaatgccactcatcagctg
ggaggcgaaaactatgtgctgtggggcggtcgcgagggctatgaaaccctgctgaatacc
gacctgcgtcaggagcgtgaacagattggccgcttcatgcaactggtggtggagcataag
cataaaattggctttaaaggcacgctgctgattgagcccaaaccgcaggaaccgaccaag
catcagtatgactatgatgcctctaccgtttacggcttcctcaaacagtttggtctggaa
aaagagattaaactgaatattgaagctaaccatgccacgctcgccggccattcgttccat
catgaaatcgcgacggccattgcgctggggctgttcggctccgtcgacgccaaccgcggc
gatccgcagctgggctgggataccgaccagttcccgaacagcgtcgaagagaatacgctg
gtgatgtatgaaattcttaaagcgggcggcttcaccaccggcggcctcaactttgatgcg
aaagtgcgccggcagagtaccgacaaatacgacctgttctatggtcatattggcgcgatg
gataccatggcgctgtcgctgaaagttgcggcgcggatgattgaggacggtgagctggat
aaacgcgtggccagacgctacgccggctggaacggtgagctggggcagcagatccttaac
gggcagatgaccctcagcgacattgcccagtatgccactcagcatcagctggcgccgcag
catcgcagcggccagcaggaacaactggaaaacctggtcaaccattatctgtttgataag
taa

DBGET integrated database retrieval system