KEGG   Klebsiella variicola At-22: Kvar_0212Help
Entry
Kvar_0212         CDS       T01170                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
kva  Klebsiella variicola At-22
Brite
Enzymes [BR:kva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Kvar_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
228326..229327
Genome map
AA seq 333 aa AA seqDB search
MPLRALVAVIVTTAVMLVPRAWADTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAML
LAVANNDRPAFDKLWQWTDSTLRDKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALL
RAQKQWQDKRYAIASDAITASLLKYTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPA
WRAFAERTHLTAWRTLQTDGQALLGQMGWGKSHLPSDWVALRADGKMLPAKEWPPRMSFD
AIRIPLYLSWADPQSALLAPWKAWMQSYPRLQTPAWINVSTNEVAPWYMAGGLLAVRDLT
LGEPQEAPQIDDKDDYYSASLKQLVWLAKQDQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcgtgctttagtggcggtgatagtgacaacggcagtgatgctggtgccccgg
gcgtgggcggatacggcctgggagcgctataaggcccgttttatgatgccggacggccgt
atcattgataccgccaatggcaatgtgtcgcatacggaaggtcagggctttgccatgctc
ctggcggtggcgaataacgatcgcccggcgttcgacaagctgtggcagtggacggacagc
accctgcgcgataagtctaacgggctgttttactggcgctataacccggtggcgccggac
cctatcgccgataaaaacaacgcctctgatggtgatactctcatcgcctgggcgctgttg
cgtgcgcaaaagcagtggcaggacaagcgctacgcgattgcctcggatgccatcaccgcc
tccctgctgaaatatacggtggtgaccttcgccggtcgtcaggtgatgctcccgggcgtg
aaagggttcaatctcaacgaccatctgaaccttaatccctcctatttcatcttcccggcc
tggcgcgccttcgcggagcggacgcatctgaccgcctggcggacattgcagaccgacgga
caggcgctgctggggcagatggggtgggggaaatcacacctgcccagcgactgggtggcg
ctgcgggcggatggcaagatgctgccagccaaagagtggccgccgcggatgagtttcgat
gcgattcgtatcccgctgtatctctcgtgggccgatccgcaaagcgctttgctcgcgccg
tggaaggcctggatgcagagttacccgcgtctgcaaaccccggcgtggatcaacgtcagc
accaacgaggtggccccctggtatatggccggcggtctgctggcggtgcgcgatctgacg
ctgggtgaaccgcaggaggcgccgcagattgacgacaaggatgattattactctgccagc
ctcaagcagttggtctggctggcgaaacaggatcagcgttag

DBGET integrated database retrieval system