KEGG   Klebsiella variicola: Kvar_0315Help
Entry
Kvar_0315         CDS       T01170                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kva  Klebsiella variicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kvar_0315
Enzymes [BR:kva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Kvar_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
351829..353925
Genome map
AA seq 698 aa AA seqDB search
MESKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRSTAATKVAVNPLPNVKI
FTHGKKMSLPVAGRGEYQWILTTEDGKQYQGKTRGGETLPLPAKLPEGYHSLTLTQEGER
WHCRTIVAPARCYEPQPLKEGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
SFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWQSAATQQ
ALQAARQTDDVDYTAVTTLKMTALRMAWKRFSRREDEQMTAFREFVLREGESLYWQAAFD
ALHAWQVQQDPLRWGWPAWPKAFQDIDSPEVKAFCIEHEDDVSFYLWLQWLAWSQFAACW
ETSQRDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SLLALESQRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFESDAEKTFRAPALYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGC
LPKRAGHKASLMSMTGILNRGMQRYIADSNSALLGLQPEDWLEMASPVNIPGTSTEYPNW
RRKLSVTLEQMFADEQVNKLIKDLDKRRKAASKKAAAR
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgcctcgataatgccgcgctggcggcgggcatcagccccagctatatc
aatgcgcacggtaagccgcagtctatcgcggctgtcaccaaacagcgcctgctggatgcg
atgcatcgctctaccgccgccacgaaagtggcggttaacccgctgccgaacgtgaaaatt
ttcacccacggcaaaaaaatgtcgctgccggtggcaggacgcggtgagtatcagtggatc
ctgaccactgaggacggtaagcagtatcaagggaaaacccgcggcggcgagacgctgccg
ctgccggctaaactgccggaggggtaccactccctgacgctcacccaggagggagagcgt
tggcactgccggaccatcgtcgcgccggcgcgctgctacgaaccgcagccgctgaaagag
gggaaaaagctgtggggcacctgcgtgcagctttataccctgcgctcggagaaaaactgg
gggatcggcgattttggcgatctgcgggccatgttgccggaaatcgcccgccgcggcggg
tcgtttattggccttaacccgatacatgctctctatccggcgaacccggagagcgccagt
ccgtatagcccgtcttcacgtcgctggctgaacgtcatctacatcgacgttaatgcggtt
gaagatttccagcgtagcgaagaggcgcaggcgtggtggcagtccgcagcgacccagcag
gccttgcaggcggcgcggcaaacggatgatgtcgactataccgcggtcaccacgctgaaa
atgaccgcgctgcgtatggcgtggaaacgattctctcgtcgtgaagatgagcagatgacg
gcgttccgcgagtttgttctgcgcgaaggggaaagcctctactggcaggccgctttcgat
gcgctgcacgcctggcaggtacaacaggacccgctgcgctggggctggccggcctggccg
aaggcctttcaggatatcgacagcccggaggtgaaagctttctgcattgagcatgaggac
gacgtcagtttctatctctggctgcagtggctggcctggagccagttcgccgcctgctgg
gaaaccagccagcgcgacgggatgccgattggcctctaccgcgatctggcggtgggcgtc
gccgaaggcgggtcggagacctggtgcgaccgtgagctgtactgcctgaaagcgtccgtg
ggcgcgccgccggatattctgggcccgctgggccagaactggggcctgccgccgatggat
ccgcatattattgccgctcgcgcctatgagccgtttatcgacctgctgcgcgccaatatg
cagaactgcggcgcgctgcgcatcgatcacgtgatgtcggtgctgcgtttgtggtggatc
ccctatggtgaaaccgccgaccatggcgcttacgttcagtatcccgtcgacgatctgctg
tcgcttctggcgctggaaagccagcgtcatcgctgcatggtgatcggcgaagacctgggc
acggtaccggtggagattgtcagcaagttacgcaacagcggcgtctattcttataaggtg
ctctattttgagagtgatgcagagaaaacgttccgcgcgccggcgctgtacccggagcaa
tcaatggctgtggcgacgacgcacgacctgcccaccctccgcggctactgggaaagcggc
gatctgacgctaggtaaagcgctggggctctatcctgatgaggtggtgctgcgcgggctg
taccaggaccgcgagctggcgaagcaagggctgctggatgcgttgcataagtacggctgt
ctgcccaaacgtgccgggcataaggcctctctgatgagcatgaccgggatcctcaaccgg
gggatgcagcgttacattgccgacagtaacagtgcgctactgggcctgcagccggaagac
tggctggagatggcgtcgccggttaacattccgggcaccagcactgagtacccgaactgg
cgccggaagctgtccgtcaccctggagcagatgtttgccgatgaacaggtcaataagctg
attaaggatctggataaacggcgcaaggcggcgagcaagaaagccgccgccagatga

DBGET integrated database retrieval system