KEGG   Klebsiella variicola: Kvar_0459Help
Entry
Kvar_0459         CDS       T01170                                 

Definition
hydro-lyase, Fe-S type, tartrate/fumarate subfamily subunit alpha (EC:4.2.1.32)
Orthology
K03779  
L(+)-tartrate dehydratase alpha subunit [EC:4.2.1.32]
Organism
kva  Klebsiella variicola
Pathway
Glyoxylate and dicarboxylate metabolism
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Kvar_0459
Enzymes [BR:kva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.32  L(+)-tartrate dehydratase
     Kvar_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
485809..486708
Genome map
AA seq 299 aa AA seqDB search
MSKSEQISRMTDIMARFVGYTGKVLPDDVTAKLKELHKKETSQLADVIFTTMIENQRLAK
ELDRPSCQDTGVIQFLVECGANFPLIGELEALLRESVIKATVDSPLRHNSVETFDEYNTG
KNVGKGTPTVFWEIVPNSDQCSIYTYMAGGGCSLPGKAMVLMPGAGYEEVTRFVLDVMTS
YGLNACPPLLVGVGVATSVETAALLSKKALMRPIGSHNDNERAASLEKMLEDGINKIGLG
PQGMSGNTSVMGVNIENTARHPSTIGVAVNVGCWSHRKGHIVFDKDLNYTITSHTGVAF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcgaacagatatcccgcatgaccgacatcatggccagatttgtgggatat
accggcaaagtattgcctgatgacgtcacggcaaaactaaaagagttgcataagaaagag
accagccagctggcggacgtcatctttaccaccatgattgaaaaccagcgtctggcgaaa
gagctggatcgtccctcctgccaggataccggcgtgatccagtttctggtggagtgcggc
gccaactttccgctgatcggcgaactggaagcgctgctgcgcgaatcggtgatcaaagcc
accgtcgactccccgctgcgtcataacagcgtcgagacctttgatgaatacaacaccggt
aaaaacgtcggtaaaggtacgccgacggtcttctgggagatcgttcccaattccgatcag
tgcagcatctacacctatatggctggcggcggctgctcgctgccgggtaaagcgatggtg
ttaatgcctggcgctggctatgaagaggtgacccgctttgtgctggatgtgatgaccagc
tatggcctgaacgcctgtccgccattgctggttggcgttggggtggcaacgtcggtggaa
accgcggcgctgctgtcgaagaaagcgctgatgcgcccgattggctcgcacaatgataac
gaacgggcggcatcgctggaaaaaatgctcgaagacggcatcaacaaaatcggtctgggc
ccgcaggggatgtccggcaatacctccgtgatgggcgtcaatatcgaaaataccgcacgc
catccttccaccattggcgtggcggtcaacgtcggctgctggtcgcaccgcaaaggacat
atcgttttcgataaagacctgaactacaccattacgtctcacacaggagtggcattctga

DBGET integrated database retrieval system