KEGG   Klebsiella variicola: Kvar_0512Help
Entry
Kvar_0512         CDS       T01170                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
kva  Klebsiella variicola
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kva00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
537936..538784
Genome map
AA seq 282 aa AA seqDB search
MKLVAQGSTLDLSHPHVMGILNVTPDSFSDGGAHNSLVEAVKHANLMINAGATIIDIGGE
STRPGAAEVSVEEELARVIPVVEAIAQRFEVWISVDTSKPEVIRESARAGAHIINDIRSL
TEPGALQAAAETGLPVCLMHMQGQPKTMQEAPKYEDVFADVERFFAEHIVRCEQAGIAKE
KLLLDPGFGFGKNLSHNYQLLARLGEFHHFGLPLLVGMSRKSMVGQLLNVGPSERLNGSL
ACAVIAAMQGAQIIRVHDVKETVEALRVVEATLAAKGKKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtagcccagggctcaaccctcgatctctctcatccgcatgtgatgggcatt
cttaatgtgactcccgactccttctccgatggcggcgctcacaactcgctggttgaggcg
gtgaagcatgccaatctgatgattaacgccggggcgaccatcattgatatcggcggtgaa
tccacgcggccaggggcggctgaggtgagcgtagaagaggaactcgcgcgggtgatcccg
gttgtcgaagcgatcgctcagcgctttgaagtgtggatctcggtggatacctccaaaccg
gaggttatccgcgaatcggcccgggcaggggcgcatatcattaacgatattcgttcgctg
accgaacctggcgcgctgcaggccgctgcggaaaccgggctgccggtgtgtctgatgcat
atgcaaggtcagccgaaaaccatgcaggaggcgccgaaatatgaggatgtcttcgccgat
gtcgagcgcttttttgcagaacatattgtgcgctgcgagcaggcggggatcgcaaaagaa
aaattgctgctcgacccgggattcggtttcggtaaaaatctctcccacaattatcagctg
ctggccagactgggtgaatttcaccactttgggctgcctttgttggttggtatgtcgcgg
aagtcgatggtaggtcagttgctgaacgtcgggccgtcagaacggctgaacggcagcctg
gcgtgtgccgtcattgcagcaatgcagggcgcgcagataatccgcgtccatgatgtcaaa
gaaacggtagaagcgctgcgcgtggtggaagccaccctcgccgctaagggaaaaaaacgt
tatgagtaa

DBGET integrated database retrieval system