KEGG   Klebsiella variicola: Kvar_0842Help
Entry
Kvar_0842         CDS       T01170                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
kva  Klebsiella variicola
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kva03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
885536..887380
Genome map
AA seq 614 aa AA seqDB search
MTFEQLLLAAVEQRLLRPLDVQFALMVAQNDPPAVMLAAALLSRDAGEGHVCLPLSRLSG
DEALSGKAGEIRDRLLAEAGAPEDWPALLLASSAVSCGDAPAPMILCGDRLYLNRMWRNE
LTVARFFNEANRVLEMDEARLASTLNALFPATGETDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALIQIDDSPRCRIRLAAPTGKAAARLTESLGAALRKLPLTDAQKALIPTE
ASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPAHGRVIFLG
DRDQLASVEAGAVLGDICAWASSGYTVARAQELTRLTGSPVPAGEGAIAGALRDSLCLLQ
KSYRFGSHSGIGSLARAVNAGARAEVKATLRQPFDDIALHPLSTTEEYEAMLGAAQQGYE
RYLQLRRERAEPQAMLAAFSEFQLLCALREGPYGVSGVNERLEQRLNRQRAIALPRHSRW
YDGRPIMISRNDSALGLFNGDIGIALERNGELRVWFLMPDGTIKSVQPSRLPEHDTAWAM
TVHKSQGSEFEHAALILPARSVPLVTRELVYTAITRAKQRLSLYADEQVLSQAIVTRTER
RSGLAEIFAGREAP
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaacaattactgctggcggcggtggagcagcgtctgctgcggccgctggac
gtccagtttgccctgatggtggcgcaaaacgacccgccggcggtcatgctggcggcggcc
ttgctgagccgggatgctggcgaggggcacgtttgcctgccgctgtcgcggttgagcggc
gacgaggcgctgagcggaaaagcgggggagatccgcgatcggctgctggccgaagccggc
gcgccggaggactggcccgcgctgctgctcgcttcgtcggcggtgagctgcggcgatgct
ccggcgccgatgattttgtgcggcgaccggctctatctgaaccggatgtggcgcaacgag
ctgaccgtcgcccgcttctttaacgaagccaaccgggtgctggagatggatgaggcgcgg
ctggcgtcaacgctaaatgcgctgtttcccgccactggcgaaaccgactggcaaaaagtg
gccgcggcggtggcgctgactcgccgtatctcggtgatctccggcggtcccgggaccggg
aaaaccaccaccgtggcgaagcttctggcggcgctgatccagattgacgacagtccacgc
tgtcgtattcgcctggcggcaccgacggggaaagcggcggcgcgcctgaccgaatcgctg
ggcgcggcgctgagaaagctgccgctgaccgacgcgcagaaagcgttaattcccaccgag
gccagcacgctgcatcgtctgctgggcgcccagcccggcagccagcgcatgcgctatcac
gccggcaacccgctgcatctggatgtgctggtcgtggatgaagcctcgatgattgacctg
ccgatgatgtcgcggcttatcgacgcgctgccggcccacgggcgggtgattttcctcggc
gatcgcgaccagctggcctccgtggaagcgggggcggtgctgggggatatctgcgcctgg
gcgagctcgggctacactgtcgcgcgggcgcaggagctgacccggctgaccggttcgccg
gtgccggcgggcgagggggctatcgctggcgcgctgagagacagcttgtgcctgctgcaa
aagagctatcgcttcggcagtcactccggcatcgggagcctggcgcgggcggtgaatgct
ggcgcgcgcgcggaggtgaaggccacgctgcgccagccgtttgacgacatcgcgcttcat
cccctcagcacgaccgaagagtacgaggccatgctcggcgcggcccagcagggctatgaa
cgctacctgcaactgcgccgcgagcgggccgaaccgcaggccatgctggccgctttcagc
gaattccagcttctgtgcgcgctgcgtgaagggccgtacggcgtgagcggcgtcaatgag
cggctggagcagcggctcaaccgccagcgggcgatcgccctgccgcgccactcccgctgg
tatgacggccgaccgatcatgatatcgcgcaacgacagcgcgctggggctgtttaacggc
gatatcggcatagcgctggagcgcaacggcgagctgcgggtgtggttcctgatgcccgac
ggcaccatcaagtcggtgcaaccgagtcgcctgccggagcatgataccgcctgggcgatg
accgtgcataaatcgcagggctccgagttcgaacatgcggcgctgatcctgccggcgcgc
agcgtcccgctggtgacccgcgaactggtctacacggcgatcacccgcgcgaaacagcga
ttgtcgctctatgccgacgagcaggtgctctcccaggccattgtgacgcgaaccgagcgg
cgcagcggcctggcggagattttcgccgggcgcgaagccccctga

DBGET integrated database retrieval system