KEGG   Klebsiella variicola: Kvar_1220Help
Entry
Kvar_1220         CDS       T01170                                 

Definition
exodeoxyribonuclease VII large subunit (EC:3.1.11.6)
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
kva  Klebsiella variicola
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:kva03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1286264..1287655)
Genome map
AA seq 463 aa AA seqDB search
MLPSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNFSQPSSGHWYFTLKDDNAQVRC
AMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQ
LTAEGLFEQKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDD
APGQIVRAIALANARQECDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAVGHET
DVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLASRQRRFTQLF
HRLQQQHPQLRLARQQTALERLRQRMRIAVESQIKRAEQRQKRTVQRLDHYNPQPRIHRA
QSRIQQLEYRLAENMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQT
KQVKTGDLLTTRLKDGWVESEVKQIAPVKKTRARKPSPAKPAE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgttaccctctcaatcccccgcaatttttaccgtaagccgcctcaatcagacggtgcgt
ctgctgcttgagcgcgaaatgggccaggtttggatcagcggcgagatctctaacttcagc
cagccctcctctggccactggtacttcaccttaaaagacgataacgcccaggtgcgctgc
gcgatgttccgcaacagcaaccgccgggtgacgtttcgcccacagcacgggcagcaggtg
ctggttcgcgccaacatcaccctgtatgagccgcgcggcgactaccagattatcgtcgaa
agcatgcagcccgccggcgaagggttattacagcagaagtatgagcagctcaaagcgcag
ttaacggcggaaggactgttcgagcaaaaacataagcaggcgctcccctctcccgcccac
tgcgtcggcgtcatcacctcgaaaaccggtgcggcgctgcacgatattctccatgtcctc
aggcgccgcgatcccgggctgccagtgattatttacccaaccgcggtccagggtgacgac
gcccccgggcagattgtgcgcgccatcgcgctggccaacgcgcgccaggagtgtgacgta
ctgattgtcggacgcggcggcggttcgctggaggatctgtggagttttaacgatgagcgg
gtggcacgggctattttcgccagccagatccctatcgttagcgccgtcggccatgaaacc
gacgtcacgatcgccgattttgttgccgacctgcgagcaccgactccctcagccgccgcg
gagatcgtcagccgcaatcagcaggagctgctgcgccagctgcagtccggacagcagcgt
ctggagatggcgatggactatttcctcgccagtcgccagcgccgttttacccagctgttc
catcgcctgcagcaacagcatccgcagctgcgcctggcccgccagcagaccgccctggaa
cgcctgcgccagcggatgcgcatcgccgtggagtcacagattaagcgcgccgaacagcgg
caaaagcgcaccgttcaacgtctggatcactacaacccgcagccacggatccaccgggcg
caatcgcggatccagcagctggaataccggctggcggaaaatatgcgtggccgcctcagc
gagcggcgtgaacggtttggcaacgcggtgacccatctggaggcggtgagtcccttagcc
actctggcgcgcggctacagcgtcacctcggtgagcgacggtacggtgctgaaacagacg
aaacaggtcaaaaccggcgatctgctcaccacccgcctgaaagacggctgggtcgaaagc
gaagtgaagcagatcgcgccggtgaaaaaaacgcgggccagaaagccttcacccgctaaa
ccagcggaataa

DBGET integrated database retrieval system