KEGG   Klebsiella variicola At-22: Kvar_1312Help
Entry
Kvar_1312         CDS       T01170                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00010  Glycolysis / Gluconeogenesis
kva00052  Galactose metabolism
kva00500  Starch and sucrose metabolism
kva00520  Amino sugar and nucleotide sugar metabolism
kva00521  Streptomycin biosynthesis
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
Module
kva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kva_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_1312
   00052 Galactose metabolism
    Kvar_1312
   00500 Starch and sucrose metabolism
    Kvar_1312
   00520 Amino sugar and nucleotide sugar metabolism
    Kvar_1312
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Kvar_1312
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Kvar_1312
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Kvar_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ADC57238
JGI: Kvar_1312
Position
1386528..1387493
Genome map
AA seq 321 aa AA seqDB search
MTKFALVGDVGGTNARLALCDLASGEISRAKTYSGLDYPSLEAVVRVYLEEHQVTVNEGC
IAIACPITGDWVAMTNHTWAFSIAEMKRNLGFAHLEIINDFTAVSMAIPMLKAEHLIQFG
GSAPVAGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
LGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPREVTERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HENPGLLGSGAHLRQTLGQVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttgctttagtaggagatgtcggggggaccaacgcccgcctggcgctatgt
gatctggcgagcggagagatctctcgtgctaagacctattccgggctcgattatcccagt
ctggaggcggtggtgcgcgtctatctggaggagcaccaggtgaccgtcaacgaaggctgt
atcgccattgcctgcccgatcaccggcgactgggtagcgatgaccaaccatacctgggcc
ttctccatcgctgaaatgaagcgcaaccttggctttgcccatctggagataattaacgat
tttaccgccgtttccatggccatcccgatgctgaaagccgagcacctcattcagtttggc
ggcagcgctccggtagcgggcaaaccgatcgccgtttatggcgccggaaccgggcttggc
gtggcgcatctggtgcacgttgacaagcgctgggtcagcctgccgggcgaaggcggtcat
gtcgattttgcgccgaacagcgaagaagaggggattattctggaagagctgcgcgccgag
ctggggcatgtttccgcagaacgcgtgctctcgggtcccggactggtcaatttgtaccgc
gcgattgtgaagtctgatggccgcctgccggaaaacctgcagccacgcgaggtcaccgag
cgagcgctggcggacagttgtaccgactgtcgccgggcgctatcgctgttctgcgtcatt
atgggccgcttcggcggaaacctggcgctgactctcgggacctttggcggcgtgtatatc
gccgggggcatcgtgccgcgcttcctggagttctttaaagcctccggcttccgcggcggt
tttgaagacaaaggccgtttcaaagcttatgttcaggatattccggtttacctgatcgtg
catgaaaacccgggcctgctgggctctggcgcgcatctgcgtcagacgctgggccaggtg
ttataa

DBGET integrated database retrieval system