KEGG   Klebsiella variicola At-22: Kvar_1548Help
Entry
Kvar_1548         CDS       T01170                                 

Definition
(GenBank) regulatory protein GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00040  Pentose and glucuronate interconversions
kva00052  Galactose metabolism
kva00500  Starch and sucrose metabolism
kva00520  Amino sugar and nucleotide sugar metabolism
kva01100  Metabolic pathways
kva01130  Biosynthesis of antibiotics
Module
kva_M00362  Nucleotide sugar biosynthesis, prokaryotes
kva_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Kvar_1548
   00052 Galactose metabolism
    Kvar_1548
   00500 Starch and sucrose metabolism
    Kvar_1548
   00520 Amino sugar and nucleotide sugar metabolism
    Kvar_1548
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Kvar_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ADC57473
JGI: Kvar_1548
Position
1662607..1663503
Genome map
AA seq 298 aa AA seqDB search
MNMANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHS
SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCAR
PVVGDNPFVVVLPDIILDGGTADPLRYNLAAMVARFNETGRSQVLAKRMPGDLSEYSVIQ
TKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTQPGAWGRIQL
TDAIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGTKFRESIKKLLA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcgaatttgaaagcggttattccggtcgcaggactaggcatgcatatgctg
ccggccacaaaggcaattccaaaggagatgctgccgatcgttgataagccaatgattcag
tacattgttgacgaaatcgtcgccgccgggatcaaagagattgtcctggtgacgcactcc
tcgaagaatgcagtggaaaaccactttgatacctcctacgagctggaagccctgcttgag
cagcgcgtgaagcgccagctgctggcggaagtccaggccatttgcccgccgggcgtaacc
atcatgaacgtgcgccaggcacagccgctggggctgggccactccattctctgcgcccgc
ccggtagtcggggacaacccgtttgtggtggtactgccggatatcattctcgatggcggc
actgcggacccgctgcgctataacctcgctgccatggtcgcccgttttaacgagaccggc
cgcagccaggtgctggcgaaacgcatgccgggcgatctctccgaatactccgttatccag
accaaagagccaatggtggccgaagggcaggtggcgcgtatcgtcgagtttattgaaaaa
ccggacgaaccgcagaccctggactccgacctgatggcggtgggccgctacgtgctgtcg
gcagatatctgggctgaacttgaacgaacccagccgggcgcctggggccgtatccagcta
accgacgccattgccgaactggcgaagaagcagtccgttgacgcgatgctgatgaccggc
gaaagctatgactgcggtaaaaaaatgggctacatgcaggccttcgtcacctacgggatg
cgtaacctgaaagaaggtaccaaattccgcgaaagcattaaaaaactgctggcctga

DBGET integrated database retrieval system