KEGG   Klebsiella variicola: Kvar_1548Help
Entry
Kvar_1548         CDS       T01170                                 

Definition
regulatory protein GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kva  Klebsiella variicola
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Kvar_1548
   00052 Galactose metabolism
    Kvar_1548
   00500 Starch and sucrose metabolism
    Kvar_1548
   00520 Amino sugar and nucleotide sugar metabolism
    Kvar_1548
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Kvar_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1662607..1663503
Genome map
AA seq 298 aa AA seqDB search
MNMANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHS
SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCAR
PVVGDNPFVVVLPDIILDGGTADPLRYNLAAMVARFNETGRSQVLAKRMPGDLSEYSVIQ
TKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTQPGAWGRIQL
TDAIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGTKFRESIKKLLA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcgaatttgaaagcggttattccggtcgcaggactaggcatgcatatgctg
ccggccacaaaggcaattccaaaggagatgctgccgatcgttgataagccaatgattcag
tacattgttgacgaaatcgtcgccgccgggatcaaagagattgtcctggtgacgcactcc
tcgaagaatgcagtggaaaaccactttgatacctcctacgagctggaagccctgcttgag
cagcgcgtgaagcgccagctgctggcggaagtccaggccatttgcccgccgggcgtaacc
atcatgaacgtgcgccaggcacagccgctggggctgggccactccattctctgcgcccgc
ccggtagtcggggacaacccgtttgtggtggtactgccggatatcattctcgatggcggc
actgcggacccgctgcgctataacctcgctgccatggtcgcccgttttaacgagaccggc
cgcagccaggtgctggcgaaacgcatgccgggcgatctctccgaatactccgttatccag
accaaagagccaatggtggccgaagggcaggtggcgcgtatcgtcgagtttattgaaaaa
ccggacgaaccgcagaccctggactccgacctgatggcggtgggccgctacgtgctgtcg
gcagatatctgggctgaacttgaacgaacccagccgggcgcctggggccgtatccagcta
accgacgccattgccgaactggcgaagaagcagtccgttgacgcgatgctgatgaccggc
gaaagctatgactgcggtaaaaaaatgggctacatgcaggccttcgtcacctacgggatg
cgtaacctgaaagaaggtaccaaattccgcgaaagcattaaaaaactgctggcctga

DBGET integrated database retrieval system