KEGG   Klebsiella variicola: Kvar_1790Help
Entry
Kvar_1790         CDS       T01170                                 

Definition
Lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kva  Klebsiella variicola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1910847..1911350
Genome map
AA seq 167 aa AA seqDB search
MTPSMRKKLIGVIAGGGGAIAIASALITGPTGNDGLEGVRYAPYQDVVGVWTVCYGHTGK
DIMLGKKYTEAECRALLSKDLNTVARQIDPYIQKPIPETMRGALYSFAYNVGAGNFQTST
LLRKINQGDQKGACEQLRRWTYAKGKQWKGLVTRREIEREVCLWGQK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgccatcaatgaggaaaaaactgattggcgtgatcgccggcggtggtggcgccata
gccattgcctctgcgctcatcactggcccaaccgggaacgatggtcttgaaggcgtgcga
tacgccccctatcaggatgtggtaggggtctggacggtctgttatggacacactggcaaa
gatatcatgctcggcaagaagtacaccgaggctgaatgccgtgcgctgctcagtaaagac
ctgaacaccgttgcccgccagattgacccatacatccagaagccgatccccgaaacaatg
cgtggggcgctttactcattcgcgtataacgtcggcgctggcaacttccagacctccacg
ctgctgcgcaaaatcaaccagggcgaccagaaaggtgcatgcgaacagctgcgccgctgg
acttacgccaagggcaaacagtggaaaggcctggtaactcgccgcgagattgagcgcgaa
gtttgtctgtgggggcagaaatga

DBGET integrated database retrieval system