KEGG   Klebsiella variicola: Kvar_1979Help
Entry
Kvar_1979         CDS       T01170                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kva  Klebsiella variicola
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Kvar_1979
   00052 Galactose metabolism
    Kvar_1979
   00500 Starch and sucrose metabolism
    Kvar_1979
   00520 Amino sugar and nucleotide sugar metabolism
    Kvar_1979
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Kvar_1979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2107128..2108030
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEFESDLSRDNLAEMISRFDETGASQIMVEPVEDVTAYGV
VDCKGESLKPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHKTLGDDFKAWLETAVTK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtcagaaaagcggttatcccggtagcgggattaggcacc
aggatgctgcctgccaccaaagcaattccaaaagaaatgctgccgctggtagataagccg
ttaattcagtacgttgttaatgaatgtatcgctgcaggaattactgaaattgttctggta
acgcactcatcgaaaaactctatcgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgtgtaaaacgccagcttctggaagaagttcagtctatttgcccgccg
cacgtgaccattatgcaagttcgtcagggcctggcgaaaggccttggtcacgccgtgctg
tgcgcacatccggtagtgggtgatgagccggtagcggttattctgccagacgttattctg
gatgaatttgagtccgatctgagccgtgataaccttgcggagatgatctctcgttttgat
gagactggcgccagccagattatggttgagcctgtcgaggatgtgaccgcgtatggcgtg
gtcgattgcaaaggcgaatccctgaagccgggcgaaagcgtgccgatggtgggcgtggtc
gagaagccaaaagctgacgttgcgccgtccaacctggcggtagtggggcgctatgtcctc
agcgcagatatttggccgctgctggcgaagacccctccgggcgccggtgatgaaattcag
ctgactgacgcgattgatatgctgatcgagaaagaaacggttgaagcttatcatatgaaa
ggcaagagccatgactgcggcaataagcttggctacatgcaggcgtttgtcgaatatggt
attcgtcacaagacgcttggtgacgattttaaagcctggctggaaaccgcggtgacgaag
taa

DBGET integrated database retrieval system