KEGG   Klebsiella variicola At-22: Kvar_1979Help
Entry
Kvar_1979         CDS       T01170                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00040  Pentose and glucuronate interconversions
kva00052  Galactose metabolism
kva00500  Starch and sucrose metabolism
kva00520  Amino sugar and nucleotide sugar metabolism
kva01100  Metabolic pathways
kva01130  Biosynthesis of antibiotics
Module
kva_M00362  Nucleotide sugar biosynthesis, prokaryotes
kva_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Kvar_1979
   00052 Galactose metabolism
    Kvar_1979
   00500 Starch and sucrose metabolism
    Kvar_1979
   00520 Amino sugar and nucleotide sugar metabolism
    Kvar_1979
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Kvar_1979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N DUF4833
Motif
Other DBs
NCBI-ProteinID: ADC57879
JGI: Kvar_1979
Position
2107128..2108030
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEFESDLSRDNLAEMISRFDETGASQIMVEPVEDVTAYGV
VDCKGESLKPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHKTLGDDFKAWLETAVTK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtcagaaaagcggttatcccggtagcgggattaggcacc
aggatgctgcctgccaccaaagcaattccaaaagaaatgctgccgctggtagataagccg
ttaattcagtacgttgttaatgaatgtatcgctgcaggaattactgaaattgttctggta
acgcactcatcgaaaaactctatcgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgtgtaaaacgccagcttctggaagaagttcagtctatttgcccgccg
cacgtgaccattatgcaagttcgtcagggcctggcgaaaggccttggtcacgccgtgctg
tgcgcacatccggtagtgggtgatgagccggtagcggttattctgccagacgttattctg
gatgaatttgagtccgatctgagccgtgataaccttgcggagatgatctctcgttttgat
gagactggcgccagccagattatggttgagcctgtcgaggatgtgaccgcgtatggcgtg
gtcgattgcaaaggcgaatccctgaagccgggcgaaagcgtgccgatggtgggcgtggtc
gagaagccaaaagctgacgttgcgccgtccaacctggcggtagtggggcgctatgtcctc
agcgcagatatttggccgctgctggcgaagacccctccgggcgccggtgatgaaattcag
ctgactgacgcgattgatatgctgatcgagaaagaaacggttgaagcttatcatatgaaa
ggcaagagccatgactgcggcaataagcttggctacatgcaggcgtttgtcgaatatggt
attcgtcacaagacgcttggtgacgattttaaagcctggctggaaaccgcggtgacgaag
taa

DBGET integrated database retrieval system