KEGG   Klebsiella variicola At-22: Kvar_2008Help
Entry
Kvar_2008         CDS       T01170                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00010  Glycolysis / Gluconeogenesis
kva00030  Pentose phosphate pathway
kva00051  Fructose and mannose metabolism
kva00052  Galactose metabolism
kva00680  Methane metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
kva01230  Biosynthesis of amino acids
Module
kva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_2008
   00030 Pentose phosphate pathway
    Kvar_2008
   00051 Fructose and mannose metabolism
    Kvar_2008
   00052 Galactose metabolism
    Kvar_2008
  Energy metabolism
   00680 Methane metabolism
    Kvar_2008
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kvar_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ADC57908
JGI: Kvar_2008
Position
complement(2137118..2138050)
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAVTFLGGKATAIFP
VGGATGEHLAALLADEQVPVETVETRDWTRQNLHVHVAASGEQYRFVMPGAALTDDEFRR
LEEKVLTIEPGSLLVVSGSLPPGISVENLMQLVKNAQQQGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQSLIQSGKVRRVVVSLGPQGALGVDASGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENAGLEDMVRFGVAAGSAATINQGTRLCSQANT
QKIYDYLCGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttatacgttaacgctggccccctcgctggatagcgccacgcagacccca
cagatttatcccgaaggtaaactccgctgcagcgcgccagtatttgagcccggcggcggc
gggatcaacgttgcccgtgccgtgacctttcttggcggcaaagccaccgccattttcccg
gttggcggcgccaccggcgagcacttagcagccctgctggccgatgagcaggtgccggtc
gagaccgtcgaaacccgcgactggacgcggcaaaacctgcacgttcacgtggccgccagc
ggcgaacaatatcgttttgtcatgcccggcgcagcgttgacggatgatgagttccgtcgg
ctggaagagaaagtcctgactatcgaacccggctcactgctggtggtaagcggcagcctg
ccgccaggtatcagcgtcgaaaacctgatgcaactggtgaaaaacgcgcaacagcaaggg
ctgcgctgcattatcgacagctccggcgacgcgctggctgcggcgctggacgtcggcaat
attgagctggtgaagccgaaccagaaagagctcagcgccctcgtacagcgcgatctgagc
caacccgatgacgtacgccttgccgcccagtcgttgatccagtccggtaaagtacgtcgg
gtggtggtttcgctcgggccgcagggggcgttaggcgttgacgccagcggcagcgttcag
gtggtgccgccgccgatgaaaagccagagcaccgtcggcgccggcgacagcatggtgggc
gccatgaccctgcgtctggcggaaaacgccgggctggaagatatggttcgctttggcgtc
gctgccggtagcgccgcgacaatcaatcagggcacccgtctctgctcgcaggccaatacg
caaaaaatctacgattatctctgcggtcgctga

DBGET integrated database retrieval system