KEGG   Klebsiella variicola: Kvar_2008Help
Entry
Kvar_2008         CDS       T01170                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kva  Klebsiella variicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kvar_2008
   01230 Biosynthesis of amino acids
    Kvar_2008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_2008
   00030 Pentose phosphate pathway
    Kvar_2008
   00051 Fructose and mannose metabolism
    Kvar_2008
   00052 Galactose metabolism
    Kvar_2008
  Energy metabolism
   00680 Methane metabolism
    Kvar_2008
Enzymes [BR:kva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kvar_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2137118..2138050)
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAVTFLGGKATAIFP
VGGATGEHLAALLADEQVPVETVETRDWTRQNLHVHVAASGEQYRFVMPGAALTDDEFRR
LEEKVLTIEPGSLLVVSGSLPPGISVENLMQLVKNAQQQGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQSLIQSGKVRRVVVSLGPQGALGVDASGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENAGLEDMVRFGVAAGSAATINQGTRLCSQANT
QKIYDYLCGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttatacgttaacgctggccccctcgctggatagcgccacgcagacccca
cagatttatcccgaaggtaaactccgctgcagcgcgccagtatttgagcccggcggcggc
gggatcaacgttgcccgtgccgtgacctttcttggcggcaaagccaccgccattttcccg
gttggcggcgccaccggcgagcacttagcagccctgctggccgatgagcaggtgccggtc
gagaccgtcgaaacccgcgactggacgcggcaaaacctgcacgttcacgtggccgccagc
ggcgaacaatatcgttttgtcatgcccggcgcagcgttgacggatgatgagttccgtcgg
ctggaagagaaagtcctgactatcgaacccggctcactgctggtggtaagcggcagcctg
ccgccaggtatcagcgtcgaaaacctgatgcaactggtgaaaaacgcgcaacagcaaggg
ctgcgctgcattatcgacagctccggcgacgcgctggctgcggcgctggacgtcggcaat
attgagctggtgaagccgaaccagaaagagctcagcgccctcgtacagcgcgatctgagc
caacccgatgacgtacgccttgccgcccagtcgttgatccagtccggtaaagtacgtcgg
gtggtggtttcgctcgggccgcagggggcgttaggcgttgacgccagcggcagcgttcag
gtggtgccgccgccgatgaaaagccagagcaccgtcggcgccggcgacagcatggtgggc
gccatgaccctgcgtctggcggaaaacgccgggctggaagatatggttcgctttggcgtc
gctgccggtagcgccgcgacaatcaatcagggcacccgtctctgctcgcaggccaatacg
caaaaaatctacgattatctctgcggtcgctga

DBGET integrated database retrieval system