KEGG   Klebsiella variicola At-22: Kvar_2157Help
Entry
Kvar_2157         CDS       T01170                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00360  Phenylalanine metabolism
kva00362  Benzoate degradation
kva00620  Pyruvate metabolism
kva00621  Dioxin degradation
kva00622  Xylene degradation
kva00650  Butanoate metabolism
kva01100  Metabolic pathways
kva01120  Microbial metabolism in diverse environments
kva01220  Degradation of aromatic compounds
Module
kva_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kvar_2157
   00650 Butanoate metabolism
    Kvar_2157
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Kvar_2157
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Kvar_2157
   00622 Xylene degradation
    Kvar_2157
   00621 Dioxin degradation
    Kvar_2157
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Kvar_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored Shikimate_DH 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADC58054
JGI: Kvar_2157
Position
2272591..2273541
Genome map
AA seq 316 aa AA seqDB search
MRKRKVAIIGSGNIGTDLMIKILRHSQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLAAN
LHQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTSQ
AIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYVLSELASQEAIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDKPVNLPGVGCFSGLKTAIYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEQMAGAMHSAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatgatt
aaaatcctgcgccacagccagcatctggagatggcggtgatggtcggcatcgacccgcag
tcggatggcctggcccgcgcccggcgcatgggcgtcgcgaccacccacgaaggggtgggc
ggcctgatgcagatggcggaatttgccgacatcgattttgtttttgacgccaccagcgcc
ggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgtcatc
gacctgacgccggcggcgattggcccgtactgcgtaccggtggtcaacctcgcggccaat
ctccatcagggcaacgtcaatatggtgacctgcggcgggcaggcgaccatcccaatggtc
gccgcggtctcgcgagtggcgaaggtgcattacgcggagatcgtggcctcgatcgccagc
caatccgccggaccgggcacgcgggccaatattgacgaatttaccgaaaccacctcgcag
gcgattgaaaaagtcggcggcgcgggcaagggcaaagcgattattgtactgaacccggcg
gagccgccgctgatgatgcgcgataccgtctacgtcctgagcgagctggcgtcgcaggag
gcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggcttacgtcccaggctac
cggctgaagcagcaggtgcagtttgaggttatccccgaggataagccggtcaacctgccc
ggcgtcggctgtttttccggcctgaaaaccgcgatttacctcgaagtggaaggggcggcg
cactatctgccagcgtacgcgggcaacctcgatattatgacctcggcggcgctggcgacg
gcggagcaaatggctggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system