KEGG   Klebsiella variicola: Kvar_2341Help
Entry
Kvar_2341         CDS       T01170                                 

Definition
beta-galactosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kva  Klebsiella variicola
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kva00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2449103..2450473)
Genome map
AA seq 456 aa AA seqDB search
MAAFPHNFLWGAATAAYQVEGGHDADGKGPSIWDIYSHLPGTTFEGTTGDVAVDHYHRFR
EDVALMAEMGLQSYRFSISWPRLLPAGRGEVNEAGVQFYSDLIDELLAHNIEPMITLYHW
DLPQALQDEGGWEARSTAEAFAEYARLCYARFGSRVKLWATFNETIVFIGHGYINGLHPP
AVRDPARAIQACHHVFIAHALAVKAFREMNVAGEIGFVNVLQPHTPLTDSEADKKATELA
DAIHTHWLYDPVLKGTYPAALLAQTQALWGVPRFAPDDDTLLRENRCDFIGLNYYRRETV
SAQPLNIPTGGEPGVEGLFYFVRNPQSSYTEWGWEIWPQGLTDGIMMIKERYGDIPIYIT
ENGLGAKDPIIAGEVVDDPRIDYLSSHIGALEKALALGADVRGYYPWSFIDLLSWLNGYQ
KQYGFVYVDHQQNLARKRKKSFYWYKSVIASHGEQR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttttccgcacaattttttatggggtgccgctaccgcagcgtatcaggttgaa
ggtgggcacgacgcagacggtaaaggaccgtcaatctgggacatctactctcacctgcca
ggcaccacctttgaaggcaccaccggcgatgtcgcggtcgaccactatcaccgttttcgc
gaagacgttgcgttaatggccgaaatgggcctgcaaagttatcgattctccatctcctgg
ccccggctgctgcccgccgggcgcggcgaagtgaatgaagccggcgtacagttttacagc
gatctgatcgacgaactgctggcgcacaatattgagccgatgatcaccctctatcactgg
gacctgccgcaggccctgcaggatgagggtggctgggaagcacgcagtaccgccgaggcc
ttcgccgagtacgcccgcctgtgctatgcgcgctttggttcacgggtgaagctgtgggcg
acctttaacgaaaccatcgtgttcattggccacggctacattaatggtctgcatcccccg
gcggtgcgcgatccggcgcgtgccattcaggcgtgtcatcacgtgtttatcgcccatgcg
ctggcggtcaaggcattccgcgagatgaatgtggcgggcgagattggcttcgtcaatgtg
ctacagccgcatactccgctcaccgacagtgaggcggacaaaaaagccaccgaactggct
gacgccatccacacccactggctttacgacccggtactgaaaggcacctatcctgccgcc
ctgctggcgcagacccaggcgctgtggggggtaccacgctttgccccggacgatgacaca
ctactgcgcgagaatcgctgtgactttatcgggctgaattactatcgccgggaaacggtg
tccgcccagccgctcaacatccccaccggtggcgaacctggcgtggaggggttgttctat
ttcgtgcgtaatccacagagcagctataccgaatggggatgggaaatctggccgcagggg
ctgacggacggcattatgatgatcaaggaacgctatggcgatatcccgatctatatcacc
gaaaatggcctgggagcgaaagacccgataattgccggagaagtggtcgacgatccgcga
atcgactacctgagcagccatattggcgccctggaaaaggcactggcgctgggggcggat
gtgcgcggctattatccctggtcgtttatcgatctgctgagctggctcaacggatatcaa
aagcagtacggctttgtctatgtcgatcaccagcaaaatctggcacgcaaacgaaagaag
agtttttattggtacaaatctgttattgccagtcacggcgaacagcgttaa

DBGET integrated database retrieval system