KEGG   Klebsiella variicola: Kvar_2732Help
Entry
Kvar_2732         CDS       T01170                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
kva  Klebsiella variicola
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Kvar_2732
  Lipid metabolism
   00600 Sphingolipid metabolism
    Kvar_2732
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Kvar_2732
Enzymes [BR:kva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Kvar_2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2835811..2838918
Genome map
AA seq 1035 aa AA seqDB search
MQISDTGHSHMPDFDAVLAREDWQNQTITHLNRLPAHPAFASWRDELAARDNHPSTRRRQ
LDGEWQFAYARSPFAVDAQWLTQDLPGSRGTPVPSNWQMEGYDAPIYTNVRYPIDTTPPR
VPEDNPTGCYSLHVEIEETWHADGQTQIIFDGVNSAFHLWCNGVWVGYSQDSRLPAAFDL
SPFLRPGDNRLCVMVMRWSAGSWLEDQDMWRMSGIFRSVWLLNKPQQRLCDVQLTPALDA
LYRDGTLQVQATIEATEAALAGLSVGVSLWRGEEQVAAGRQPLGTPAVDERGHYAERVDF
ALAVTAPAHWSAETPNCYRAVVTLWRGDELLEAEAWDIGFRRIEIVDGLLRLNGKPLLIR
GVNRHEHHHLRGQVVTEADMVQDILLMKQNNFNAVRCSHYPNAPRWYELCNRYGLYVVDE
ANIETHGMVPMNRLSDDPAWLPAFSARVTRMVQSNRNHPCIIIWSLGNESGGGGNHEALY
HWLKRNDPSRPVQYEGGGADTTATDIICPMYARVERDQPIPAVPKWGIKKWISLPGEQRP
LILCEYAHAMGNSLGNFADYWQAFREYPRLQGGFIWDWADQAIRKIFDDGSVGWAYGGDF
GDKPNDRQFCMNGLVFPDRTPHPSLVEAKHAQQYFQFTLLSTSPLRVRITSEYLFRPTDN
EVVRWQVQSAGETLYHGNLTLALPPEGSDEITLLDSLILPEGARAVWLTLEVTQPRATAW
SEAEHRVAWQQFPLPAPLALPAPTVPAGAPDLIVSDEVWQIRAGSQCWTIDRRTGLLSRW
SVGGQEQLLTPLRDQFIRAPLDNDIGVSEVERIDPNAWVERWKSAGLYDLEAHCVQCDAQ
RLANETLVDCRWHYLRGEEVVIVSHWRMHFTADGTLRLAVDGERAETLPPLPRVGLHFQV
ADQQAPVSWLGLGPHENYPDRRSSACFARWEQPLAAMTTPYIFPTENGLRCDTQALDWGR
WHVSGHFHFSVQPWSTRQLMETDHWHKMQAEDGVWITLDGLHMGVGGDDSWTPSVLPQWL
LSQTRWQYEVFLRCL
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattagcgataccggccacagccatatgcccgactttgacgccgtcctcgcccgt
gaagactggcagaaccagaccattacccaccttaaccgcctgccggcgcatcccgctttc
gccagctggcgcgatgagcttgccgcccgggataaccatccctccacacgccgccgtcag
ctggacggcgagtggcagttcgcttacgcccgcagcccgttcgccgtcgatgcgcagtgg
ctgacgcaggatttgccgggcagccgcggcacgccagtgccttccaactggcagatggag
ggctatgacgcgccgatctacaccaacgtccgctatcccatcgataccacgccaccgcgg
gtaccggaggataacccgaccggctgttattccctgcacgttgagatcgaagaaacctgg
cacgcggatggacagacgcagattattttcgatggcgtcaactcggcgtttcatctgtgg
tgcaatggcgtctgggtcggctattcgcaggacagtcgcctgccggcagcgttcgatctc
agccccttcctgcgcccgggcgacaaccgcctgtgcgtgatggtcatgcgctggagcgcc
ggcagctggctggaagaccaggatatgtggcggatgagcggcattttccgctctgtgtgg
ctgctgaataagccgcagcaacggctatgcgacgtgcagttgacgccagccctcgacgcc
ctttaccgcgatggcactctgcaggtccaggcaactatcgaagcgacagaggcggcgctt
gccgggctcagcgtcggggttagcctgtggcgcggcgaggagcaggtcgccgccgggcgg
cagccgttaggcaccccggcggtggatgaacgcggccactacgcggaacgggtcgatttt
gctctggcggtgacggcgccggcgcactggagcgcggaaactccaaactgttatcgcgcc
gtggtcaccctgtggcgcggcgacgaactgctggaggccgaagcatgggacatcggtttt
cgccgcatcgagattgtcgatggcctgctgcgtctcaacggcaaaccgctgctgatccgc
ggcgttaaccgccatgagcatcatcatttgcgcggtcaggtggtcaccgaggcggatatg
gtgcaggacattctgttgatgaagcagaacaactttaacgccgtgcgctgctcgcactac
cccaacgcgccgcgctggtatgaactctgcaaccgctacggtctgtacgtggtcgatgaa
gctaatattgaaacccacgggatggtgccgatgaatcggctgtccgacgatccggcgtgg
ctgccagccttcagcgcccgcgtcacccggatggtacagagcaaccgcaaccatccgtgc
attatcatctggtcgctgggcaacgagtccggcggcggcggcaaccacgaagcgctgtac
cactggctgaaacgcaacgacccgagccgtccggtgcagtacgagggcggcggcgcggat
accaccgccaccgatattatctgtccgatgtacgcccgcgtcgaacgcgaccagccgatc
ccggcggtaccgaaatgggggatcaaaaaatggatcagcctgcccggcgagcagcggccg
ctgatcctttgcgaatatgcccacgcgatgggcaacagcctcggcaacttcgccgattac
tggcaggccttccgcgagtatccgcggttgcagggcgggtttatctgggactgggccgac
caggcgatccgcaaaatctttgacgacggcagcgtcggctgggcctatggcggcgacttt
ggcgataagcctaacgatcgccagttctgtatgaatggtctggtgtttcccgatcgcacg
ccgcatccgtcgctggtggaggcgaagcacgcccagcagtattttcagttcacgctgctg
tcgacctcgccgctgcgggtgcgcatcaccagcgaatacctgttccgtccaaccgataac
gaagtggtgcgctggcaggtgcagtcggccggtgaaaccctgtatcacggcaacctgacc
cttgcgctgccccctgagggcagcgacgagataacgctgctcgacagcctgatcctgcct
gaaggcgcccgcgcggtgtggctgacgctggaggtgacccagccccgggcgaccgcctgg
tcagaagcggaacaccgcgtcgcctggcaacagtttcccctgcccgccccgctggcgctg
ccggcgcccaccgtgcctgccggcgctccggatcttatcgtcagcgacgaggtctggcag
atccgcgccggttcgcaatgctggaccatcgatcgccggacgggtctgctgagccgctgg
tcggttggcggtcaggagcagctgttgacccccctgcgtgaccagtttattcgcgcaccg
ctcgacaacgacatcggggtcagcgaagtagagcgcatcgaccccaacgcctgggtggag
cgctggaaaagcgccggcctgtacgatcttgaggcgcactgcgtccagtgcgatgcgcag
cgcctggcaaatgaaaccctcgtcgactgtcgctggcactatctgcgcggcgaagaggta
gtgattgtcagccactggcgcatgcacttcaccgcggacggtacgctgcggctggcggtg
gacggcgaacgggcagaaaccctgccgccgctgccgcgggtcgggctgcacttccaggtg
gcggatcagcaggcgccggtgagctggctggggctggggccgcatgagaactaccccgac
cggcggagcagcgcctgcttcgcccgctgggagcagccgctggcggcgatgacgacgccc
tacatcttcccgacggaaaacggcctgcgctgtgatacccaggcgctggactggggacgc
tggcacgtcagcggtcatttccacttctccgttcagccgtggagtacccgtcagctgatg
gagaccgaccactggcacaagatgcaggccgaagacggcgtgtggatcaccctcgacggc
ctgcatatgggggtgggcggcgatgactcctggacccccagcgtgctaccgcagtggctc
ctgagtcaaacgcgctggcagtacgaggtctttttgcgttgcctttaa

DBGET integrated database retrieval system