KEGG   Klebsiella variicola At-22: Kvar_3056Help
Entry
Kvar_3056         CDS       T01170                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00260  Glycine, serine and threonine metabolism
kva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01130  Biosynthesis of antibiotics
kva01230  Biosynthesis of amino acids
Module
kva_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kvar_3056
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kvar_3056
Enzymes [BR:kva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kvar_3056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-ProteinID: ADC58942
JGI: Kvar_3056
Position
3187583..3188776
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDETNVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTADGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRADYVSITDNEALDAFKALSRHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttactgaacccctacttcggcgaattcggcggcatgtatgtgccgcagatc
ctgatgcccgccctgcgccagctggaagaagcctttgtcagcgcgcagaaggacccggcc
tttcaggcggaattcactgacctgctgaaaaactacgccggacgtccgacggccctgacc
aaatgccggaatctgaccgaaggtactcgcaccaccctgtacctgaaacgcgaagatctg
ctgcacggcggcgcgcacaaaaccaaccaggtgctgggccaggctctgctggccaaacgg
atgggtaaaaccgaaattatcgccgagaccggcgccggtcagcacggggtcgcctcagcg
ctggccagcgccctgctcggcctgaaatgccgtatctacatgggggccaaggacgtcgag
cgccagtcgccgaacgtcttccgtatgcgcctgatgggtgccgaggtgatcccggtgcac
agcggctccgccacgctgaaagatgcctgtaatgaggcgctgcgcgactggtctggtagc
tacgagaaggcgcactatatgctgggcaccgccgccggtccgcatccgttcccgaccatt
gtacgtgaattccagcgcatgattggcgaagagaccaaagcgcagatcctcgaaaaagag
ggacgtctgccggacgcggtgatcgcctgcgttggcggtgggtcaaacgccatcggcatg
tttgccgactttattgatgaaaccaacgtcggcctaatcggcgtggaaccggccgggcat
ggtatcgaaagcggcgagcacggcgcgccgctgaagcatggccgcgtggggatctacttc
ggtatgaagtcgccgatgatgcagaccgccgacggccagatcgaagagtcttactccatt
tccgccgggctggacttcccgtccgttgggccgcagcacgcgtttctgaacagcaccggt
cgcgctgactatgtgtcgatcaccgacaacgaagcgctggacgcgtttaaagcgctctcc
cgccacgaagggattatcccggcgctggagtcctctcacgctctggcccacgcgctgaag
atgatgcgcgagaacccggaaaaagagcagctgctggtggttaacctctccggtcgcggc
gacaaagacattttcaccgtacatgacatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system