KEGG   Klebsiella variicola At-22: Kvar_3118Help
Entry
Kvar_3118         CDS       T01170                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00010  Glycolysis / Gluconeogenesis
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_3118
Enzymes [BR:kva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Kvar_3118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADC59003
JGI: Kvar_3118
Position
3250548..3251432
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVNETISPVISRRQLDDLELIVIDHPQVKASVALQGAHLLSWKPAGEEEVLW
LSNNTPFKQGVALRGGVPICWPWFGPSAQQGLPSHGFARNLPWTLEGHDEDDSGVMLTFA
LQHSAETMKLWPHEFTLYARFKLGKTCEIELEAHGEFETTSALHTYFNVGDIAAVKVSGL
GERYIDKVKNAEEGVLSNGVQTFPDRTDRVYLNADSCSVIHDDALNRTIDVVHHHQHNVV
AWNPGPALSVSMGDMPDDGYKTFVCVETCCVTQPQKASEETPSRLAQTISLKKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaatttttgctctcccggtgaatgaaaccatttctcccgtgatctcccgt
cgccagctggacgacctggagctgattgtcatcgaccatccgcaggtgaaagcctctgtg
gcgctgcagggagcgcacctgctctcctggaaacccgccggtgaagaagaagtcttgtgg
ctgagcaacaacaccccatttaaacagggcgtcgccctgcgcggcggcgtgccgatttgc
tggccctggtttggcccttccgcgcagcagggtctgccgtcgcacggctttgcccgcaat
ctgccatggaccctggaaggtcatgacgaagacgacagcggcgtcatgttgacctttgcg
ctccagcacagcgccgaaaccatgaagctctggccgcacgaattcaccctctatgcccgc
ttcaagctgggcaaaacctgcgaaatcgagctggaagcccacggtgaattcgagaccacc
tctgccctgcatacctacttcaacgtcggcgatatcgcagcggtgaaagtgagtggtctt
ggcgagcgctatatcgataaagtgaagaatgccgaagaaggcgtcctgagcaacggcgtg
cagaccttcccggaccgcaccgaccgcgtctaccttaacgctgacagctgcagcgtgatc
catgacgatgcgcttaaccgcactatcgacgtcgtgcatcatcatcagcacaacgtggtg
gcctggaacccgggcccggcgctgtccgtcagcatgggcgacatgccggacgatggttac
aaaaccttcgtttgcgtcgaaacctgttgcgtgacccagccgcagaaagccagcgaagag
accccctctcgcctggcgcagaccatcagcctgaaaaaacgctaa

DBGET integrated database retrieval system