KEGG   Klebsiella variicola At-22: Kvar_3260Help
Entry
Kvar_3260         CDS       T01170                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kva  Klebsiella variicola At-22
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kvar_3260
   01230 Biosynthesis of amino acids
    Kvar_3260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_3260
   00051 Fructose and mannose metabolism
    Kvar_3260
   00562 Inositol phosphate metabolism
    Kvar_3260
Enzymes [BR:kva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kvar_3260
Exosome [BR:kva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kvar_3260
  Exosomal proteins of bladder cancer cells
   Kvar_3260
  Exosomal proteins of melanoma cells
   Kvar_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3390710..3391504
Genome map
AA seq 264 aa AA seqDB search
MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPPFTAIQPVSHFLQMHQ
LPLLTGAQNMHEAGQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA
LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSHQQALQILIAYEPVWAIGEHG
TPASPQEAGVIHQALREALCERFGHETGIRIPLLYGGSVTLQNAVELLRQPEINGLFIGR
AAWDAQGYCDIVQRVTQEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgatatggttaggaaccagctggaaaatgaataagccgctgtcgcaggccatg
gcctggtgcgaaacgctggcagcgcggatgccagagggctgtcaccctgctattcagccc
ttcgtcattccccccttcaccgcgatccaacccgtcagccattttctgcaaatgcatcag
ttaccacttttgaccggcgcgcagaatatgcatgaagcgggtcagggcgcctggaccggg
gaaatctcggcggccatgttggcagaaaccggcgccacgcttgttgagctgggacattca
gaacgacgcgccgcctttaatgaaagcgatgccgcgattaatcgaaaagtacatagcgcc
ttaggtcatggcctgcgcccactgatctgtattggcgatagcgccgaggagaaacgctgg
caggtgtcgcgtgaaagcgtggtgcggcagatgaagatcgccctgtatggcctgagccac
cagcaagcgctgcagatcctgattgcgtatgaaccggtgtgggccattggcgaacatggt
acgcccgcctcaccgcaggaggcgggcgtcattcatcaggcgttgcgtgaggcgctttgc
gagcggtttggtcatgagacgggaatccgtatcccactgctctatggcggcagcgttaca
ctgcaaaacgcggtggaactgctgcgccagccggagatcaatggcttgtttatcggccgc
gcggcctgggacgcacaaggctattgcgacattgttcaacgcgttacacaggaatttatt
ttgcaggcgcagtaa

DBGET integrated database retrieval system