KEGG   Klebsiella variicola: Kvar_3591Help
Entry
Kvar_3591         CDS       T01170                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
kva  Klebsiella variicola
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Kvar_3591
   00500 Starch and sucrose metabolism
    Kvar_3591
Enzymes [BR:kva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Kvar_3591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3764243..3765526
Genome map
AA seq 427 aa AA seqDB search
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTTARPILNADEAKNFTPAAYFQ
SLTPNAAAWTPSAISLPAQPDFIVGPAGTQGVTHTTVQAAVDAAIARHSNRRLFIAIMPG
EYPGTVYVPAAPGALTLYGTGDKPIDVKISEAIDSEMDRNTWRRLVNPGGKYMPGKPAWY
MFDSCQNKSAATVGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVALRTDGDQV
QINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIR
DSVINEGFNIAQPWAAAVGSNRAFSGNVGAVDAKGNLQRNLNDNSVNRMWEYNNRGVGST
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatattccgtttcccgtctggcgctggcgctggccttcggcgtgacgctgtcc
gcctgtagctcgacgcctgccgatcaacagccctctacgcagactgcaccgggcaccacc
gcgcgtcccattctgaacgccgatgaagcgaaaaactttaccccggcggcctatttccag
tcgctgactcccaatgccgcggcctggacgccatctgccatcagcctgccggcgcagcct
gactttatcgttggcccggcgggaacccagggcgtgacccataccaccgtccaggcggcg
gtcgatgcggcgattgcccgtcattcaaatcgccgtctgtttattgccatcatgcctggc
gagtacccgggaacggtttacgtaccggcggcgcctggcgccctgaccctgtatggtacc
ggcgataaaccgattgacgtgaaaatcagcgaagccattgattctgaaatggatcgcaac
acctggcgccgtctggtcaatccgggcggtaaatatatgccgggcaaaccggcatggtat
atgttcgatagctgccagaataaatccgcggccaccgtcggcgtgatgtgctctgcggtc
ttctggtcgcagaataacggcctgcagctgcagaacctgaccatcgccaacaaccttggc
gacagcgtcgacgccggtactcaccaggccgtcgccctgcgcaccgatggcgatcaggtg
cagatcaacaaggtcaatattcttggccgtcagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaggataaccgccagacccgcaccctggtgaccaacagctacatt
gaaggcgatgtggatatcgtgtccggtcgcggcgcggtggtatttgataacaccgatttc
cgcgtggtgaactcgcgtacccagaaagaagcctatgttttcgcgccggctaccctgaag
agcgtgacctacggcttcctggcgaccaacagccgctttaccgcgtccggcgataacgtc
gcgcagctgggccgcgcgctggacgttgacggcaacagcaatggccaggtcgtgatccgc
gacagcgtcatcaatgaaggctttaacatcgcccagccgtgggcggcagcggtcggttca
aaccgtgcctttagcggtaacgttggcgcagtagatgccaaaggcaatctgcagcgcaac
ctcaacgacaatagcgtcaatcgcatgtgggaatataacaaccgcggcgtgggaagcact
gtggtcgccgagccgaaacagtaa

DBGET integrated database retrieval system