KEGG   Klebsiella variicola At-22: Kvar_3618Help
Entry
Kvar_3618         CDS       T01170                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00010  Glycolysis / Gluconeogenesis
kva00260  Glycine, serine and threonine metabolism
kva00680  Methane metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
kva01230  Biosynthesis of amino acids
Module
kva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kva_M00002  Glycolysis, core module involving three-carbon compounds
kva_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_3618
  Energy metabolism
   00680 Methane metabolism
    Kvar_3618
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kvar_3618
Enzymes [BR:kva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kvar_3618
Membrane trafficking [BR:kva04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Kvar_3618
Exosome [BR:kva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kvar_3618
  Exosomal proteins of melanoma cells
   Kvar_3618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADC59498
JGI: Kvar_3618
Position
3792413..3793165
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggttcgtcatggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtacgacgttgatctgtccgagaaaggcgttagcgaagcgaaagcg
gcaggtaaactgctgaaggctgaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaagctgaacgagcgtcattacggcgcgctgcagggcctgaacaaa
gcggaaaccgctgagaaatacggtgacgagcaggttaaacagtggcgtcgcggcttcgct
gtcactccgccggagctgaccaaagacgacgagcgctacccgggccacgatccgcgctat
gcaaaactgaccgacgccgaactgccgaccactgaaagcctggcgctgaccatcgaccgc
gtcgtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtgatc
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatcctcgaactgaacatcccgaccggcgtaccgctggtgtatgagttcgatgaa
aacttcaagccgatcaaacattactatctgggcaatgcggaagagatcgcggcgaaagcg
gctgccgtcgccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system