KEGG   Klebsiella variicola At-22: Kvar_3618Help
Entry
Kvar_3618         CDS       T01170                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kva  Klebsiella variicola At-22
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kvar_3618
   01230 Biosynthesis of amino acids
    Kvar_3618
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_3618
  Energy metabolism
   00680 Methane metabolism
    Kvar_3618
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kvar_3618
Enzymes [BR:kva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kvar_3618
Exosome [BR:kva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kvar_3618
  Exosomal proteins of melanoma cells
   Kvar_3618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3792413..3793165
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggttcgtcatggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtacgacgttgatctgtccgagaaaggcgttagcgaagcgaaagcg
gcaggtaaactgctgaaggctgaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaagctgaacgagcgtcattacggcgcgctgcagggcctgaacaaa
gcggaaaccgctgagaaatacggtgacgagcaggttaaacagtggcgtcgcggcttcgct
gtcactccgccggagctgaccaaagacgacgagcgctacccgggccacgatccgcgctat
gcaaaactgaccgacgccgaactgccgaccactgaaagcctggcgctgaccatcgaccgc
gtcgtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtgatc
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatcctcgaactgaacatcccgaccggcgtaccgctggtgtatgagttcgatgaa
aacttcaagccgatcaaacattactatctgggcaatgcggaagagatcgcggcgaaagcg
gctgccgtcgccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system