KEGG   Klebsiella variicola: Kvar_3638Help
Entry
Kvar_3638         CDS       T01170                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kva  Klebsiella variicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kvar_3638
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kvar_3638
  Amino acid metabolism
   00310 Lysine degradation
    Kvar_3638
Enzymes [BR:kva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Kvar_3638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3811614..3812840)
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGATVLSRQILGRLREGNSAGKETSEKADAKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDAAAIKGTGVGGRLTREDVEKHLAKAPAAAEAKAPAATAAATPAPQLGHRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaaccgtc
gccacctggcataaaaaaccgggcgacgcggtcgtccgtgacgaagttctggtcgaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcagtg
ctggaagacgagggcgctaccgtcctgtctcgccagatccttggccgcctgcgtgaaggc
aacagcgcaggtaaagaaaccagcgaaaaagcggatgcgaaagcgtccaccccggcgcag
cgccagcaggcttctctggaagagcagaacaacgatgcgctcagcccggcgatccgtcgt
ctgctggcggagcacaacctcgacgccgctgccatcaaaggtaccggcgtgggtggccgt
ctgactcgtgaagacgtcgagaaacatctggcgaaagccccggcggcggctgaagccaaa
gcgccagcggctaccgcggcagcgacaccagcgccgcagctgggtcaccgttcagaaaaa
cgcgtcccgatgacccgtctgcgtaaacgcgtggccgagcgtctgctggaagcgaaaaat
tccaccgccatgctgacgacctttaacgaagtcaacatgaagccgattatggatctgcgt
aagcagtacggcgatgccttcgaaaaacgtcacggtatccgtctgggcttcatgtccttc
tacgtgaaagcggtggttgaagcgctgaaacgctatccggaagtgaacgcttccatcgat
ggcgacgacgtggtttaccacaactactttgacgtcagcatggcagtgtccactccgcgc
ggcctggtaaccccggttctgcgtgacgttgacctgctgggcatggcggacatcgaaaag
aatatcaaagagctggcagtgaaaggccgtgacggcaagctgactgtagatgacctgacc
ggcggtaacttcaccattaccaacggcggcgttttcggttccctgatgtccacgccgatc
atcaacccaccgcagagcgccatcctgggtatgcatgccattaaagaccgtccgatggcg
gtgaatggcaaggtagagatcctgccgatgatgtacctggcgctctcctatgaccaccgt
ctgatcgatgggcgtgaatcggttggcttcctggtggcgattaaagagctgctggaagat
ccgactcgtctgctgctggacgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system