KEGG   Klebsiella variicola: Kvar_3771Help
Entry
Kvar_3771         CDS       T01170                                 

Definition
carbohydrate kinase, FGGY-like protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kva  Klebsiella variicola
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kva00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3964905..3966425
Genome map
AA seq 506 aa AA seqDB search
MQATAKEFIIALDEGTTNAKAVVLDSRGKVIVKFSQPLAIQTPRDGWVEQSGEALVTASL
TVIASAVAHVGAENVAALAISNQRETAIGWYRDSGEPINAAITWQCTRSAAFCDKLRHDR
QEQHIKRATGLPIAPLFSASKMRWLLDATVDGHLRAERGEICLGTIDSWLLWNLTAGEAF
CCDYSNAARTQLLNLHRGEWDDEMLALFGIPRAALPDIKPSSGLFGHTKGLAAIPDGIPI
MAMIGDSHAALFGHALGEAGCVKATYGTGSSVMAPVKSAQCDIDALATTVAWHDGDQLVW
GLEGNIPHTGDAVAWMADSTGLSELSAAELAHELNTLPASVDSTLGVYFVPALTGLGAPW
WDDSARGVICGLSRGVKRAHLIRAALESITYQIADVVVAMRQHEEFTLTALMVDGGPTNN
DWLMQYQADLLGCPVMRSDVPELSAIGAALLARKALHPGSTADLQAFLTEHSTFQPDMAR
HQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacagcaaaagagttcatcattgccctggatgaaggcaccaccaacgccaaa
gcggtggtgctggatagccggggcaaagttatcgtcaaattctcgcagccgctggcgatc
caaacgccgcgcgacggctgggtggagcaatcgggcgaagcgctggtgaccgcctcactg
acggtgatcgccagcgcggtggcccacgttggcgcggaaaacgtcgccgcgctggccatc
agcaaccagcgggaaaccgccatcggctggtatcgcgacagcggtgaaccgattaacgcg
gcgatcacctggcaatgcacccgcagcgccgcgttctgcgataagctgcgtcacgatcgt
caggaacagcacattaagcgtgccaccggcctgccaatcgccccgctgttctcggcctcc
aaaatgcgctggctactggatgcgactgtcgatggccacctgcgcgccgaacgcggtgag
atttgcctcggcaccatcgacagctggctgctgtggaatctgaccgctggagaagccttc
tgctgcgactactccaatgccgcccgcacccagttgctgaacctgcaccgcggcgagtgg
gacgacgagatgctggcgttgttcggcattccgcgcgcggcgttgccggacattaaaccg
tcgagcggcctcttcggccataccaaaggactggccgccattccggacggtattccgatc
atggcgatgatcggcgactcccacgcggcgcttttcggccacgcgctcggcgaggcaggc
tgcgtcaaagccacctacggcaccggctcttcggtcatggccccggtcaaatcggcccag
tgcgatatcgacgcgctggcgaccactgtcgcctggcacgatggcgaccagctggtgtgg
ggcctggaagggaatattcctcacaccggcgatgccgtcgcctggatggcggacagcacc
ggcctgagcgaactctctgccgccgagctggcccatgagctgaataccctccccgcctcc
gtcgactcaaccctcggggtctacttcgtgccggcgctgaccggtcttggcgcgccctgg
tgggacgacagcgcccgcggcgtgatttgcggcctgagtcgcggagtgaaacgcgcgcat
ctgatccgtgcggcgctggagtccatcacctatcagatagccgacgtggtggtagcgatg
cgtcagcatgaggagttcaccctgacggcgttgatggtggacggcgggccgaccaacaat
gactggctgatgcaataccaggccgatctgctcggctgcccggtgatgcgcagcgacgtg
ccggagctgtccgccatcggcgcggcgttgctggcgcgcaaagcgctccatcctgggtcg
accgccgatctgcaggccttcttaaccgaacacagcacctttcagcccgacatggcccgc
caccagcgtttacaaacgcgctggcaggagtggcgccatgcggtcgaccgaacattatgg
aaaccggactcgccagcctga

DBGET integrated database retrieval system