KEGG   Klebsiella variicola At-22: Kvar_3864Help
Entry
Kvar_3864         CDS       T01170                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kva  Klebsiella variicola At-22
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Kvar_3864
   00500 Starch and sucrose metabolism
    Kvar_3864
Enzymes [BR:kva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Kvar_3864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
4067208..4068608
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVSGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPDGYTGHVRDPKVWQQDGCWYMVLGAQDLQ
QHGKVLLFTASDLREWRLVGEIAGHGVNGLANGGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGTFDHGPLHELDSGFEFYAPQTMLAEDGRRLLVGWMGV
PDGEEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELAALREEAQGWRGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgcctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcagcggactgctgaac
gatcccaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgtgaccatacctataagtgctggggacactggagttcagccgatctgctgcac
tggcggcatgaacctatcgccctgatgccggacgaagagtatgaccgcaacggctgctac
tccggcagcgcggtcgagttcgagggcgccctgaccctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgtaccgcctggcagtgcctggcgacagagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctccctgacggttacaccggccatgtacgcgac
cccaaggtgtggcagcaggacgggtgctggtacatggtcctcggcgcgcaggatttgcaa
cagcacggtaaagtgctgctgttcaccgccagcgatctgcgggagtggcgcctggtgggc
gagatcgccggacatggcgttaacggtctggcgaacggcggctatatgtgggagtgcccg
gatctctttccgctggcggatacccacctgctgatctgctgcccgcaggggctggcccgt
gaagcgcagcgctttctcaatacctatccggcggtgtggatggcaggccgcttcgacgcc
gaacgcggcaccttcgaccacggcccgctgcacgagctggacagcgggtttgagttctac
gcgccgcagaccatgctggccgaggatggccgccgtctgctggtcggctggatgggcgtc
ccggacggggaagagatgcatcaacccacccgcgcacagggatggatccaccagatgacc
tgcgtgcgcgagctggagtggcaggcgggcaccctgtatcagcgcccgctgcgcgagctg
gccgctctgcgcgaggaagcccagggctggcgcgggcagaccctgcccctcgccccgatg
gagctggcctttgacatcgcccccaacagcacgctggggctggactttgccggcgccctg
cagcttaccgtcaaccgtgacggcctgcgtctgtcgcgccgcgggctgcagaccgccgag
atgcatcaccgctactggcgcggcgaagcgcggcgcctgcggatctttatcgaccgctcc
agcgtggaaattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggc
tatccggggcagttaatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagtataa

DBGET integrated database retrieval system