KEGG   Klebsiella variicola: Kvar_3909Help
Entry
Kvar_3909         CDS       T01170                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
kva  Klebsiella variicola
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Kvar_3909
Enzymes [BR:kva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Kvar_3909
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Kvar_3909
Lipid biosynthesis proteins [BR:kva01004]
 Fatty acid synthase
  Component type
   Kvar_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4117938..4118564
Genome map
AA seq 208 aa AA seqDB search
MMNFKYVFRWHVPFLFLFLFTCRAMAADTLLILGDSLSAGYRMAANAAWPALLNEKWQAK
TPVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFPPQQTEQTLRTIIKD
IKAANAEPLLMQIHLPANYGRRYNEAFGAIYPALAKEFDIPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMANRLAPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagtatgttttccgctggcatgtgcctttcctgtttttgttcctgttt
acctgccgcgcaatggcggcggacacgctgctgatcctcggcgacagcctgagcgctggc
tatcgaatggcggccaacgccgcctggcctgcgctgctcaatgagaagtggcaggcgaaa
acaccggtggtgaacgccagcatcagcggcgatacctcgcagcaggggctggcccgcctg
ccagcgctgcttaagcagcatcagccgcgctgggtgctggttgagctcggcggcaatgac
gggctgcgcggttttccgccacagcagaccgagcaaacactgcgcaccattattaaagat
atcaaagcggccaacgccgagccgctgctgatgcaaattcacctgccggcgaactatggc
cgccgctataatgaagccttcggcgcgatttacccggccctggccaaagagttcgatatt
cctctcctgcctttttttatggaggaggtctatctcaaaccgcaatggatgcaggacgac
ggcattcacccaaatcgcgacgcgcagccgtttatcgccgactggatggcgaaccggctg
gctcccttagttaatcatgactcctga

DBGET integrated database retrieval system