KEGG   Klebsiella variicola: Kvar_3927Help
Entry
Kvar_3927         CDS       T01170                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kva  Klebsiella variicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Kvar_3927
DNA repair and recombination proteins [BR:kva03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Kvar_3927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4138465..4139070)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIHAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESITEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgcatggcgtttaccctgctgcagcgcgatcgcagcggcggt
atgcgcctggcgcaggcgctgacgcgcgcgatgtcggagatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatctgcagcaacccgcgtcgccaggaaaac
ggccagatctgcgtggtggagagtccggcggacatccacgccatcgagcagaccgggcag
tattccggccgctacttcgtgctgatggggcacctgtcgccgctcgacggcatcgggcca
gatgacatcgggctcgatcgccttgaacaacggctggaagcggagtcgatcaccgaggtg
atccttgccactaacccgaccgttgagggtgaggcgacggccaactacatcgcggagctg
tgcgcgcagtatggcgttgatgccagccgcatcgcccacggcgtgccggtgggcggcgag
ctggaaatggtcgacggcaccacgctgtcccactcgctggccggtcgtcacaagattact
ttctga

DBGET integrated database retrieval system