KEGG   Klebsiella variicola: Kvar_4065Help
Entry
Kvar_4065         CDS       T01170                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
kva  Klebsiella variicola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kvar_4065
Enzymes [BR:kva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Kvar_4065
Exosome [BR:kva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kvar_4065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4279988..4280962
Genome map
AA seq 324 aa AA seqDB search
MTDLITRPRRLRQSAALRALFEETTLSLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKY
LAREIERIANAGIRSVMTFGISHHTDATGSDTWNENGLVARMSRICKSTVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRRSLD
AAGFTNTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERSDLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatcactcgcccccgccgcctgcgtcaatccgctgcgctgcgcgccctg
tttgaagagacaacactgagtttgaacgacctggtgttgccgatctttgttgaagaagaa
attgatgattacaaagcgatcgaggccatgcccggcgtgatgcgcattccggaaaaatat
ctggcacgtgaaatcgaacgcatcgccaacgccggcattcgctcggtgatgacctttggc
atttctcatcacaccgatgctaccggcagcgatacctggaatgaaaatggcctggtggcg
cgtatgtcgcggatctgcaagtccacggtgccggagatgatcgtcatgtccgatacctgc
ttctgcgaatacacttcccacggtcactgtggcgtgctgtgcgaccacggggtggataac
gacgcgaccctggaaaacctcggcaagcaggccgttgtcgccgccgccgccggggcggat
ttcatcgctccttccgccgcgatggacggtcaggtacaggcgattcgccgctcgctggat
gccgccggtttcactaatacggcgattatgtcctactccaccaagttcgcttcctccttc
tacggcccgttccgcgaagcggccggtaccgcgctgaagggcgatcggaaaacctatcag
atgagcccgatgaaccgccgggaagccattcgcgagtcgctgctcgatgaagcccagggc
gccgactgtctgatggtgaaaccggctggcgcctacctggatattctgcgcgatatccgc
gaacgcagcgatctgccgctcggcgcctatcaggtcagcggggagtacgcgatgatcaaa
ttcgctgcccaggcgggcgctatcgatgaagagaaagtggttctggaaagcctcggcgct
atcaaacgcgcaggcgccgacctgatcttcagctatttcgccctcgatctggccgagaaa
aaaatcctccgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system