KEGG   Klebsiella variicola At-22: Kvar_4263Help
Entry
Kvar_4263         CDS       T01170                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00010  Glycolysis / Gluconeogenesis
kva00020  Citrate cycle (TCA cycle)
kva00620  Pyruvate metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
Module
kva_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_4263
   00020 Citrate cycle (TCA cycle)
    Kvar_4263
   00620 Pyruvate metabolism
    Kvar_4263
Enzymes [BR:kva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Kvar_4263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: ADC60140
JGI: Kvar_4263
Position
complement(4499418..4501310)
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGKLIMIFDSAEGAAAAAPAQEEKKEATPAAPAAAAAAKEVHVPDIGGDEVEVT
EIMVKVGDTIAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMIFEVAG
AAPAAAPAQAAAPAAAAPAAAGGAKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVE
GDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAQAAAPAPAAAPA
QAAKPAAAPAAKAEGKTEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAVKRAESAPAAAAGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagtagaagctgaacagtcgctgatcaccgtagaaggcgat
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagattaaagtctcc
gtcggcgacaaaaccgagactggcaaactgattatgattttcgattccgccgagggtgca
gcagccgctgcaccagcgcaggaagagaagaaagaagccactccggctgcgccagcagct
gccgcggcagcgaaagaagttcacgtcccggatatcggcggcgatgaagttgaagttacc
gagatcatggttaaagtgggcgacaccatcgccgctgagcaatccctgatcaccgtagaa
ggcgataaagcctctatggaagtgccggcgccgttcgcgggtaccgtgaaagagatcaaa
atcaacaccggtgacaaagtgtccaccggctccctgatcatgatcttcgaagtggcgggc
gctgcgcctgccgccgcacctgctcaggctgctgctccggcggcggctgctccagctgcg
gctggcggtgcgaaagacgttaacgtaccggacatcggcggcgacgaagttgaagtcacc
gaagtgatggtcaaagtcggcgataaagtggctgctgagcagtccctgatcaccgtcgaa
ggcgacaaagcgtctatggaagtgccggcgccattcgcaggtaccgtcaaagagatcaaa
atcagcaccggcgataaagtcaaaactggttccctgatcatggtcttcgaagtggaaggc
gctgcgcctgccgccgcgccggctcaggctgctgctccggcaccggctgctgcaccggct
caggccgctaagcctgccgctgcaccggctgcgaaagcagaaggcaaaactgaattcgct
gaaaacgatgcttacgttcacgcgacgccgctgattcgccgcctggcgcgcgagttcggc
gttaacctggcaaaagtgaaaggcaccggccgtaaaggtcgtatcctgcgcgaagacgtt
caggcttatgtgaaagacgcggttaaacgcgctgaatccgcaccggcggctgccgctggc
ggcggtatcccgggtatgctgccatggccgaaggttgacttcagcaagtttggtgaaatc
gaagaagtggaactgggccgtatccagaaaatctctggggctaacctgagccgtaactgg
gtgatgatcccgcacgttacccacttcgacaaaactgatatcaccgatctggaagcgttc
cgtaagcagcagaacgccgaagctgagaagcgtaaactggacgtgaaattcaccccagtg
gtcttcatcatgaaagccgttgccgctgcgcttgagcagatgccgcgcttcaacagctcg
ctgtccgaagatggtcagcgcctgacgctgaagaaatacatcaacatcggtgtggcggtt
gataccccgaacggtctggtggttccggtcttcaaagacgtgaataagaagagcatcacc
gagctgtctcgtgaactgaccaccatctcgaagaaagcgcgcgatggcaagctgacggct
ggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggcactacccac
ttcgcgccgattgttaacgcgccggaagtggccatcctgggcgtgtctaagtccgcgatg
gagccggtatggaatggtaaagagttcgttccgcgtctgatgatgccgatctctctgtcc
ttcgaccaccgcgtcatcgacggtgctgatggtgcccgcttcattaccatcattaacaac
accttgagcgacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system