KEGG   Klebsiella variicola: Kvar_4338Help
Entry
Kvar_4338         CDS       T01170                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
kva  Klebsiella variicola
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kva00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:kva00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4591083..4591562)
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFLPKAHKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtagatcgcgtcattggtatggaaaacgccatg
ccatggaacctgcctgccgatctcgcctggttcaaacgcaacacgttaaataagccggtg
gtgatggggcgtctgacctgggaatccattgggcgcccgttgccggggcgtaaaaatatc
gtgatcagcagcaaacccggcagcgacgatcgcgtgcagtgggtctcctcagtggaggaa
gcgattgctgcctgcggcgatgtggaagagattatggtgattggcggcggccgcgtttat
gagcagttcctgccgaaagcgcataagctctatctgacgcacattgatgcggaagtggaa
ggcgatacccatttcccggattacgacccggacgagtgggagtcggtgttcagcgagttt
catgacgctgacgcgcagaactcccacagctactgctttgagatcctcgaacgccgttaa

DBGET integrated database retrieval system