KEGG   Klebsiella variicola At-22: Kvar_4769Help
Entry
Kvar_4769         CDS       T01170                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00010  Glycolysis / Gluconeogenesis
kva00620  Pyruvate metabolism
kva00640  Propanoate metabolism
kva00680  Methane metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
kva01130  Biosynthesis of antibiotics
kva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kvar_4769
   00620 Pyruvate metabolism
    Kvar_4769
   00640 Propanoate metabolism
    Kvar_4769
  Energy metabolism
   00680 Methane metabolism
    Kvar_4769
Enzymes [BR:kva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Kvar_4769
Lipid biosynthesis proteins [BR:kva01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Kvar_4769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADC60640
JGI: Kvar_4769
Position
5066342..5068300
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPANIAERCLINPEQYKAQYQQSITDPDTFWGEQGKILDWIRPYTRVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDASQSKHITYRELHADVCRF
ANVLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGLRAGRAIPLKKNVDDALKNPNVNSIEHVVVLKRTGGKIDWQEGRDLWWSDL
MANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVSILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPVLVDNEGLPLDGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacacaaacaccctattcccgctaatatcgcggaacgttgcctgattaac
ccggaacagtacaaggcgcagtaccaacaatccataaccgaccctgatacattttggggc
gagcagggcaagatccttgactggatacgcccctatacccgcgtgaagaacacctctttc
gcgccgggtaatatttccatcaaatggtatgaagatggcaccctgaacctcgccgccaac
tgcctcgaccgccatctcgccgagcgcggcgatcaaaccgccatcatctgggaaggcgac
gacgccagccagagcaagcacatcacctaccgtgaactgcatgcggacgtgtgccgcttc
gccaatgtgctgctcgaccttgggattaaaaaaggcgatgtggtcgccatttatatgccg
atggtgccggaagccgcggtggcgatgctggcctgcgcccgcatcggcgctatccactca
gtgattttcggcggcttctcgccggaggcggtggccggacgcattatcgactccagctcg
cgcctggtgatcaccgctgacgaagggctgcgcgctggtcgcgccatcccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaacagtattgagcatgtcgtggtcctg
aaacgtaccggcggcaaaatcgactggcaggaaggccgcgacctgtggtggagcgacctg
atggccaatgccagcgccgagcaccggcccgtcgagatgaacgccgaagatccgctgttc
atcctctatacctccggctccaccggcaaaccgaaaggggtgctgcacaccaccggcggc
tatctggtctacgcggccaccacctttaaatacgttttcgactaccatccgggcgatatt
tactggtgcaccgccgatgtgggctgggtcaccggccacagctatctgctgtatggtccg
ctggcctgcggcgccaccaccctgatgttcgaaggggtaccgaactggccaaccccggcg
cgtatgtgccaggtcgtcgataagcataaggtcagcattctctataccgccccgacggct
atccgcgccctgatggcggaaggcgacaaagctatcgaaggcacagaccgttcctcgctg
cgcattctcggctcggtcggcgaaccgattaacccggaagcatgggagtggtactggaag
aagatcggtaacgagaagtgcccggtgatggacacctggtggcagaccgaaaccggcggc
tttatgatcaccccgctgccgggcgcaatcgagctgaaggccggctccgcgacgcgtccg
ttcttcggcgtccagccggtgctggtggataacgaaggcctgccgctggatggcgccacc
gagggcaatcttgccatcgccgactcctggcccggccaggcgcgtaccctgttcggtgac
catgagcgctttgagcaaacctacttctccaccttcaaaaatatgtactttagcggcgat
ggcgcgcgtcgcgatgaagatggttactactggatcactggccgcgtggatgacgtgctg
aacgtctccggccaccgtctgggtaccgcggaaattgaatccgcgctggtgtcgcacccg
aaaatcgctgaagcggcggtggtggggatcccgcacaacatcaaaggccaggccatctac
gcctacgtgacgctcaatcacggcgaagaaccaacgccggagctgtatgccgaagtgcgt
aactgggtgcgcaaagagatcggcccgctggcgacgccggatgtgctgcactggaccgat
tcgctaccgaaaacccgctcgggcaaaatcatgcgtcgcattctgcgtaagattgccgcg
ggcgacaccagcaacctcggcgatacctcgacgctcgccgatcctggcgtcgtggaaaaa
ctgctcgaagagaagcaggccataacgatgccatcgtaa

DBGET integrated database retrieval system