KEGG   Klebsiella variicola At-22: Kvar_4929Help
Entry
Kvar_4929         CDS       T01170                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00860  Porphyrin and chlorophyll metabolism
kva01100  Metabolic pathways
kva01110  Biosynthesis of secondary metabolites
kva01120  Microbial metabolism in diverse environments
Module
kva_M00121  Heme biosynthesis, glutamate => heme
kva_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kvar_4929
Enzymes [BR:kva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Kvar_4929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ADC60800
JGI: Kvar_4929
Position
5258480..5259220
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEALVSRLRAMGRVAWSFPLIEFTPGRELPVLGDHLAHLGSDDLLFALS
QHAVEFAHARLQQQGLPWPTSPHYFAIGRTTALALHTVSGQHIRYPLDREISEVLLQLPE
LQNIAGKNALILRGNGGRELLGATLAERGARVTFCECYQRSAKHYDGAEEAMRWQSRGVT
TLVVTSGEMLQQLWSLIPQWYREQWLLHCRVVVVSERLALQARELGWQEIQVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcactcgtccactcccgcaaggggaagcgctggtcagccgtctgcgg
gccatgggacgcgtggcctggagctttccgctgatagaatttacgcctggccgggagctt
cccgtgctgggcgaccatcttgcccatctggggtccgacgacctgctgtttgcgctatcc
cagcatgcggtggaattcgcccatgcccgtctgcagcagcaaggcctgccctggcccact
tctccgcactattttgccattggtcgaacgacggcgctggccctgcatacggtcagcggg
cagcacatccgttacccgttagatcgggaaattagcgaagtcttgctacaattacctgaa
ttacaaaacattgccgggaaaaatgcgctgatcctacgcggcaatggtgggcgggaactc
ttaggcgccacgctggctgaacgcggcgccagggtcacattttgtgaatgttatcaacgt
agtgcaaaacattacgatggcgcagaagaagcgatgcgctggcagtctcgcggggtcacc
acgctggtggtcaccagcggtgagatgctgcagcagctgtggtcgttaataccgcaatgg
tatcgcgaacaatggctcctgcactgccgcgttgtcgttgtcagcgaacgtctggccctt
caggcccgggaactgggctggcaggagattcaggttgccgataacgctgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system