KEGG   Klebsiella variicola: Kvar_5018Help
Entry
Kvar_5018         CDS       T01170                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
kva  Klebsiella variicola
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Kvar_5018
  Lipid metabolism
   00561 Glycerolipid metabolism
    Kvar_5018
   00600 Sphingolipid metabolism
    Kvar_5018
Enzymes [BR:kva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Kvar_5018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5366382..5368505)
Genome map
AA seq 707 aa AA seqDB search
MSDSLIHLQSAGADVVIKTRPFAEIVYWGPHLSHFSPQDADSLTRPVANGRLDVDSPVTL
MAELGHGLFGAPGIEGHRQGLDASPLFTTSEVRHEGQTLTLVSEDPQAGLRLHSEIALDA
SGVLSVRHGVTNLRASPWQVDRLAVTLPVAERAREVMAFHGRWIREFQPHRLTLEHDSFV
LENRRGRTSHEHFPALITGSRAFSEMQGEVWGVHLAWSGNHRLRAEVKTDGRRYLQAEAL
YLPGEMALAEGETLWTPYLYASYSANGLNGMSQQFHRYLRERIIRFPGNKPRPVHLNTWE
GIYFDHDPDYIMRMADEAAALGVERFIIDDGWFKGRNDDWAALGDWYLDEKKYPHGLTPV
IDHVKSLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGYTPLTGRHQFVLNLNIPEAFD
YLLERMSWLLGEHAVDYVKWDMNRELVQPGHQGRAAADAQTRQFYRLLDTLVARFPHIEF
ESCSSGGGRIDYEVLKRSHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGNRHCHAT
FRQHSIAFRGLTALFGHMGLELDPVSADEEERAGYRKYAALHKQWRDVIHHGVQWRMDMP
DATTLAHGVVSPDKAQAIFLVSQLAMPDYTLMAPLRLAGLEANARYQVTLLDHPNIQITG
EGGHTMRKLPAWMTTPQTVSGEWLQQAGLALPILDPESAILIGLQRV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcgctgattcacctgcaaagtgccggtgccgatgttgtcattaaaactcgc
cctttcgccgaaattgtctactgggggccccatttaagccacttttcaccgcaggatgcc
gacagcctgacgcgcccggtcgccaacggcagactggatgtcgattcgccagtgacctta
atggcagagctgggccatggcctgtttggtgcgccgggcattgaaggccatcgtcagggt
ctggatgcctctccgctgttcaccaccagcgaagtgcggcacgagggccagacgctgacc
ctggtcagcgaagatccgcaggccggcctgcgtctgcacagcgagatcgcgctggatgcc
agcggcgtgctgagcgtgcgccatggcgtgaccaatctgcgcgccagcccatggcaggtg
gatcgcctggcggtcacattgccggtcgccgaacgcgctcgcgaggtgatggctttccat
ggccgctggatccgcgagtttcagcctcaccgcctgacgctggagcacgacagctttgtg
ctggagaaccgccgcgggcgcacctctcacgaacatttcccggccctgatcaccggcagc
cgcgcctttagcgagatgcagggtgaagtctggggcgtacatctggcctggagcggtaac
catcgcctgcgggcagaggtgaaaaccgatggccgccgctatctacaggccgaggcgctc
tatctgccgggtgaaatggcgctggcggaaggggaaaccttgtggacaccgtacctgtat
gccagctactcggcgaacgggctgaacggcatgagccagcagttccatcgttatctgcgc
gaacggattattcgcttcccgggcaacaagccgcgcccggtgcatctcaacacctgggag
gggatctatttcgaccacgacccggactacatcatgcgtatggctgacgaggcggcggcg
ctgggcgtcgagcgctttattatcgatgacggctggtttaaagggcgcaacgacgactgg
gcggcgcttggggactggtatcttgatgagaaaaagtacccccacggcctgacgccggtt
atcgatcatgtgaaatcgctggggatggaattcggtatttgggtggagccggaaatgatt
aacccggattccgatctgtaccgggcgcacccggactgggtgctggcgctgccgggctat
accccgctgaccggccgccatcagtttgtcctgaatcttaacattccggaagcgtttgat
tatctgctggagcggatgagctggctgctgggcgagcacgcggtggactacgtgaagtgg
gatatgaaccgcgagctggtgcagcctgggcatcagggacgcgccgccgcggacgcgcaa
acgcgccagttctaccgcctgctggatacgctggtggcccgtttcccgcacattgaattt
gaatcctgctcctccgggggcgggcggatcgattatgaagtcctcaagcgcagccatcgc
ttctgggcgtctgacaacaatgacgcccttgagcgcaacaccatccagcgcggcatgagc
tacttcttcccgccggaggtgatgggcgcgcatatcggcaaccgccactgtcatgccacc
ttccgccagcacagtatcgccttccgcggcctgacggcgctgtttggtcatatgggactt
gagctggacccggtgagcgctgatgaagaagagcgcgccggataccggaaatatgcggcc
ttgcataaacagtggcgcgacgtgatccatcacggcgtgcagtggcggatggatatgccg
gacgctaccacccttgcccacggcgtcgtcagcccggataaagcgcaggcgattttcctc
gtcagccagctggcgatgccggactacaccctgatggcgccgctgcgcctggcggggctg
gaggcgaacgcccgctatcaggtgacgctcctcgatcatccgaacattcagatcaccggc
gagggcggccacaccatgcggaagctgccggcatggatgacgacgccgcagacggtgagc
ggtgagtggctacagcaggcggggctggcgctgcccatcctcgacccggaaagcgccatt
ctgattggcctgcaacgcgtgtga

DBGET integrated database retrieval system