KEGG   Klebsiella variicola DX120E: KR75_03890Help
Entry
KR75_03890        CDS       T03531                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kvd  Klebsiella variicola DX120E
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KR75_03890
   00500 Starch and sucrose metabolism
    KR75_03890
Enzymes [BR:kvd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KR75_03890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
861652..863085
Genome map
AA seq 477 aa AA seqDB search
MTYTISRAEQVLQTKRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSMDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMIVGAREGD
TGQVRLYRSTDLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAEGFRN
RNLFQSGYLIGEWQPGQRFIRHGEFREMDHGHDFYAPQSFATPDGRRIMIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADNRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNCE
AMEVHLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVVERYYPQFGLCGTRSVPLTAGA
DLNLRIFFDSSSVEVFVNDGEACLSSRIYPQVPCRELALFAWSGSAALTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaatctcccgggctgaacaggtactgcagacaaaacgccaggcgctcaat
ctgcgctggtatccacactatcacctggcggcccgcgccgggtggatcaacgaccctaac
ggtctggtgtggttcgacggctggtaccatgccttttatcagcatcacccgtattccacc
cagtgggggccgatgcactgggggcacgcgcgcagtatggatctggtgcactgggagcac
ctgccggtggcgctggcgccggaggggccggaagataaagacggctgcttctccggttcg
gcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggcgat
cctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacgggatc
cactttgagcgccaggggatggtggtcgacacccctccaggcatgcaccacttccgcgac
ccgaaggtctggcgggaaggggatagctggtacatgatcgtcggcgcgcgcgaaggcgat
accggccaggtgcggctgtaccgttcaaccgatctgcgccagtggcaggatgcgggcgtg
ctggatgaagcggaaagcaccatgggctacatgtgggagtgcccggacttcttcactctc
aacggtaagcgcgtcctgatgttttccccacaggggatgcaggccgaagggttccgcaac
cgcaatctgttccagagcggctatctgatcggcgagtggcagccggggcagcgttttatt
cgccacggcgaattcagggagatggaccacggccacgatttctatgccccgcaaagcttc
gccacccccgatggccggcggatcatgattggctggctggatatgtgggaatcgccgctg
ccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctgagc
gcggataaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcctgg
ttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgcgag
gcgatggaggtgcacctgcgctgggactgcgcccgcagcagcgctgagcagtatggtctg
cgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctggtggtggag
cggtattatccgcagtttggcctgtgcgggacgcgcagcgtgccgttgaccgccggggcg
gatctcaacctgcggatatttttcgatagctcttcggttgaggttttcgtcaatgatggc
gaagcctgcctgagcagccgtatctatccgcaggtcccttgccgtgaattagcgttattt
gcctggagcggctcagctgcattaactgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system