KEGG   Klebsiella variicola DX120E: KR75_14410Help
Entry
KR75_14410        CDS       T03531                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00052  Galactose metabolism
kvd00500  Starch and sucrose metabolism
kvd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KR75_14410
   00500 Starch and sucrose metabolism
    KR75_14410
Enzymes [BR:kvd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KR75_14410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJA95998
UniProt: A0A0B7GCS0
Position
4152090..4153490
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVSGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPDGYTGHVRDPKVWQQDGCWYMVLGAQDLQ
QHGKVLLFTASDLREWRLVGEIAGHGVNGLANGGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGTFDHGPLHELDSGFEFYAPQTMLAEDGRRLLVGWMGV
PDGEEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELAALREEAQGWRGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgcctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcagcggactgctgaac
gatcccaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgtgaccatacctataagtgctggggacactggagttcagccgatctgctgcac
tggcggcatgaacctatcgccctgatgccggacgaagagtatgaccgcaacggctgctac
tccggcagcgcggtcgagttcgagggcgccctgaccctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgtaccgcctggcagtgcctggcgacagagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctccctgacggttacaccggccatgtacgcgac
cccaaggtgtggcagcaggacgggtgctggtacatggtcctcggcgcgcaggatttgcaa
cagcacggtaaagtgctgctgttcaccgccagcgatctgcgggagtggcgcctggtgggc
gagatcgccggacatggcgttaacggtctggcgaacggcggctatatgtgggagtgcccg
gatctctttccgctggcggatacccacctgctgatctgctgcccgcaggggctggcccgt
gaagcgcagcgctttctcaatacctatccggcggtgtggatggcaggccgcttcgacgcc
gaacgcggcaccttcgaccacggcccgctgcacgagctggacagcgggtttgagttctac
gcgccgcagaccatgctggccgaggatggccgccgtctgctggtcggctggatgggcgtc
ccggacggggaagagatgcatcaacccacccgcgcacagggatggatccaccagatgacc
tgcgtgcgcgagctggagtggcaggcgggcaccctgtatcagcgcccgctgcgcgagctg
gccgctctgcgcgaggaagcccagggctggcgcgggcagaccctgcccctcgccccgatg
gagctggcctttgacatcgcccccaacagcacgctggggctggactttgccggcgccctg
cagcttaccgtcaaccgtgacggcctgcgtctgtcgcgccgcgggctgcagaccgccgag
atgcatcaccgctactggcgcggcgaagcgcggcgcctgcggatctttatcgaccgctcc
agcgtggaaattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggc
tatccggggcagttaatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagtataa

DBGET integrated database retrieval system