KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0011Help
Entry
KVU_0011          CDS       T01909                                 

Definition
glycoside hydrolase family 3 domain-containing protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KVU_0011
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    KVU_0011
Enzymes [BR:kvl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KVU_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10511..12187
Genome map
AA seq 558 aa AA seqDB search
MTDQTLRAMLSGAPFNLDQVAIDWVAATHASLSDAEKIGQLFVISSMGFDPTEADRLRDF
APAGITRFFFGDKATEAGFIDQLRCEAKVPLLFSADLEGSRMSLPFGAEAPNPLALAAID
DVDATHEVSTIMAREAAALGMNWSFTPVIDINHAFRSSIVATRSFGADVARVQRHALAAI
DAFQAQGIAATVKHWPGEGFDDRDQHLVTTINPLSLAEWEASFGTLYRAAVDAGVKSVMS
AHIALPAFVREMMADAGVEAFRPASVSRYLNIDLLRGRLGFNGVIVSDATMMAGFGAWGP
RAQMIPEVIENGCDIILFSDDPVEDAGFVAAALADGRLSRARLDEALFRSLGLKASLGLH
KGVPAQQLDLIGTAADRIRAAEITRRAPTLVKDVQGLLPLSVEKHRRIYVYTTGVVSPMH
TAGGPLALVDMLRAEGFEVTVHDRDNAQMNPWKGYDLVLYLMAEETLLSRERIFMNWAGL
AGQFLRAMERPWHDVPTALISFGYPYYLYDAPRMPCVINAYATMDTMQQAVLDGLMGRAP
FTGTSPVDPFCGLPDAPF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcagactctgcgcgccatgctttctggcgcgccgttcaacctggatcaggtg
gcgattgattgggtcgccgccacccatgccagcctgtcggatgcggaaaagatcgggcag
ttgttcgtcatctcctcgatggggttcgacccgaccgaggcggatcgcctgcgcgatttc
gcccccgctggcatcacgcggttcttttttggcgacaaagcgacagaggccggtttcatc
gaccagctgcgctgcgaggcgaaagtcccgttgctcttcagtgccgatctggaaggcagc
cggatgagcctgccgttcggggccgaggcgccgaacccgctggctttggccgctatcgat
gatgtcgatgcaacgcatgaggtctcgaccatcatggcgcgcgaggcggcggctttgggg
atgaactggtcgttcacgccggtcatcgacatcaaccacgccttccgctcgtccatcgtg
gcgacgcgcagctttggcgcggatgtggcgcgggtccagcgtcatgccttggccgcgatt
gatgcgttccaggcgcagggcatcgccgcgacggtgaaacactggccgggcgaggggttt
gacgaccgcgaccagcatctggtcaccacgatcaacccgctgtcgctagcagagtgggag
gcgagctttggcacgctttaccgcgcggcggtcgatgcgggcgtgaaatcggtaatgtcg
gcgcatatcgcgctgcccgcctttgtgcgcgagatgatggcggatgcgggggtcgaggcc
ttccgccccgcttcggtcagccgttacctgaacatcgacctgcttcgcggacgtttgggc
tttaacggtgtcatcgtgtccgatgcgacgatgatggcaggctttggcgcttggggcccg
cgcgcgcagatgatccccgaggtgattgaaaacggctgcgatatcatcctgttctcggac
gatccggtcgaggatgcgggctttgtcgctgcggctttggcggatggtcgcctcagccgc
gcgcgtctggacgaggctttgttccgctcgctggggctgaaggcttcgctcgggctgcac
aagggcgtccccgcgcagcagttggatctgatcggcaccgccgccgaccgcatccgcgcg
gccgaaatcacccgccgcgcaccgacgctggtcaaggatgtgcaggggctgctgccgctg
tctgtcgaaaagcaccgccgaatctatgtctatacgacgggtgttgtctcgccgatgcat
actgctggcgggccgctggcgctggtcgatatgctgcgcgccgaggggttcgaggtcacc
gtccatgaccgtgacaatgcgcagatgaacccgtggaagggctatgaccttgtgctttac
ctgatggccgaggaaaccctgctgtcgcgtgagcgcatcttcatgaactgggcgggcctt
gcgggccagttcctgcgcgcgatggagcgtccatggcatgatgtgccgaccgctttgatt
tcgttcggctatccctattacctttatgatgcgccgcgtatgccctgtgtcatcaacgcc
tatgccaccatggatacgatgcagcaggcggtgctggatgggttgatgggccgcgcgccc
tttacaggcacatcgcccgttgatccgttctgcggtctgcctgacgcgccattctga

DBGET integrated database retrieval system