KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0270Help
Entry
KVU_0270          CDS       T01909                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00260  Glycine, serine and threonine metabolism
kvl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01130  Biosynthesis of antibiotics
kvl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KVU_0270 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KVU_0270 (trpB)
Enzymes [BR:kvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KVU_0270 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 12373110
NCBI-ProteinID: YP_005794105
UniProt: F9Y9C7
Position
303200..304426
Genome map
AA seq 408 aa AA seqDB search
MADTLINSFMTGPDDNGRFGDFGGRFVSETLMPVVLALQAEYEKAKTDQTFWDEMDDLWF
NYVGRPSPLYFAERLTTALGGAKIYMKREDLNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCIVYMGATDVERQAPNVFRMKLLGAEVIPVKSGRGTLKDA
MNDAMRDWVTNVHDTFYCIGTVAGPHPYPAMVRDFQAVIGKETREQILKHEGRLPDTLVA
AVGGGSNAMGLFHPFLDDEAVKIVGVEAGGHGVDDRMEHCASLTGGRPGVLHGNRTFLLQ
DEDGQILEGHSISAGLDYPGIGPEHAWLHSIGRVKYESITDAEALDAFQKCCEYEGIIPA
LESSHALAQVIKMAPGLPQDHIIVMNLSGRGDKDIFTVARHLGVDIQA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacattgatcaatagtttcatgacagggccggatgacaacggtcgtttcgga
gactttggtgggcgtttcgtttccgaaaccttgatgcccgtcgtgcttgcactgcaggcc
gaatatgaaaaagccaaaacagatcagaccttctgggacgagatggacgatctgtggttc
aactacgtcggccgccccagcccgctgtatttcgccgagcgtctgacaaccgcccttggc
ggtgcgaaaatctatatgaagcgcgaggatctgaaccacaccggcgcgcataagatcaac
aacgtgctgggccagatcattctggcacgtcgcatgggcaagacgcggatcatcgccgaa
accggcgcgggtcagcacggtgttgcgaccgcgaccgtctgcgctaaattcggcctgaaa
tgcatcgtctatatgggcgccaccgacgttgaacgtcaggccccgaacgtgttccgtatg
aagctgctgggcgccgaggttattccggtgaagtcgggtcgcggcacgctgaaagatgcg
atgaacgacgcgatgcgcgattgggtgaccaacgtccatgacacattctattgcatcggc
acggttgccgggccgcatccctatcccgcgatggtgcgcgatttccaagccgtcatcggc
aaagagacgcgcgagcagatcctgaaacacgaaggccgtctgcccgatacgctggtggcg
gctgtgggcggtggctcgaacgcgatggggctgttccacccgttccttgatgacgaggcg
gtcaagatcgtcggcgtcgaggcgggcggccacggcgttgacgaccggatggagcattgc
gccagcctgaccggcgggcgcccgggcgtgctgcatggcaaccgcaccttcctgctgcag
gatgaggatggccagattttggaaggccattcgatctcggcaggcctcgattatccgggc
atcgggccggaacatgcctggctgcattcgatcggccgcgtgaaatacgaatcgatcacc
gacgccgaggcgcttgatgccttccaaaagtgctgtgaatacgaggggatcatccccgcc
ctcgaatcatcccacgcactggcgcaggtgatcaaaatggcccccggcctgccgcaggac
catatcatcgtcatgaacctgtcggggcggggcgataaagatatcttcaccgtcgcccgc
caccttggggtggatattcaggcctaa

DBGET integrated database retrieval system