KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0274Help
Entry
KVU_0274          CDS       T01909                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00260  Glycine, serine and threonine metabolism
kvl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01130  Biosynthesis of antibiotics
kvl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KVU_0274 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KVU_0274 (trpA)
Enzymes [BR:kvl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KVU_0274 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-GeneID: 12373114
NCBI-ProteinID: YP_005794109
UniProt: F9Y9D1
Position
complement(307116..307907)
Genome map
AA seq 263 aa AA seqDB search
MSRIDAKFAQLRAEGRKAFVSYVMAGDPDYETSLEIVKGLPAAGVDIIELGMPFTDPMAD
GLTIQAAGQRALDGGQTLEKTLDIVRALRKVDNTTPVVMMGYYNPIYSRGVTRFLSDARE
AGIDGLIVVDLPPEEDSELCIPARDYDINFIRLATPTTDNARLPTVLQNTSGFVYYVSVN
GITGTAAASAAAVGPEVARIKAATDLPVIVGFGIRSPEAAESIASVADGCVIGSAIVAQI
ADGKPVSEVLSFVADLAAGAHRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcattgatgccaaattcgcccagcttcgcgccgaggggcgcaaggcctttgtc
tcttacgtgatggcgggcgaccccgattatgaaacatcgctggagatcgtgaaaggcctg
cccgccgctggcgtcgatattatcgaactgggtatgccctttaccgatccgatggccgat
ggcctgaccattcaggcggcgggccaacgcgcgctggacggcggccaaacgctggaaaag
acactggatatcgtgcgcgcgctgcgcaaggtcgacaatacgacccccgtcgtgatgatg
ggctattacaacccgatctattcgcgcggcgtgacgcggttcctgtccgacgcgcgcgag
gcgggcatcgacggtctgatcgtcgtcgacctgccgcccgaggaagacagcgagctgtgc
atccccgcccgcgattacgatatcaacttcatccgcttggcgacgcccaccaccgataat
gcgcgcctgccgacggtgctgcaaaacacatcgggctttgtctattacgtctcggtcaat
ggcatcaccggcaccgccgccgccagcgccgccgctgtgggtcccgaggttgcacggatc
aaagcggccaccgatctgccggtgatcgtcggtttcggcatccgctcgcccgaggcggct
gaaagcattgcaagtgtcgcggatggctgcgtcatcggctcggccattgtggcgcagatt
gccgacggcaaacccgtctccgaggtgctgtcctttgtcgccgatctcgccgcaggcgcg
caccgggcctaa

DBGET integrated database retrieval system