KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0417Help
Entry
KVU_0417          CDS       T01909                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KVU_0417 (recR)
DNA repair and recombination proteins [BR:kvl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KVU_0417 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(467037..467627)
Genome map
AA seq 196 aa AA seqDB search
MDDSSDIARLIALMARVPGLGPRSARRAVLHLVKKRSQLMVPLGNAMQAVAQSARECLNC
GNISTHDICPICADTARANGQICVVEDIDDLWAMERTGAFKGRYHVLGGTLSAIDAIGPE
ELRIPRLVDRVTTENITEVILALGATIDGQTTAHYIADHLSGIIVSTLAQGVPIGGELDY
LDDGTIGAALRARRQL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtggatgacagcagcgacatcgcccgtctgatcgcgctgatggcgcgtgtgcccggtctt
gggccgcgttccgcgcggcgggcggtgttgcatctggtgaaaaagcgcagccagttgatg
gtgccgcttggcaatgccatgcaagcggtggcgcaatcagcgcgcgaatgcctgaattgc
ggcaatatcagcacccatgacatctgcccgatctgcgcagataccgcccgcgccaacggc
cagatttgcgtggtcgaggatattgacgatctgtgggcgatggaacgcacgggcgccttc
aagggccgctatcatgtccttggtggcacgttatccgccatcgacgccatcggccccgag
gagttgcgcattccgcgtctggtcgatcgcgtcacgaccgaaaatattaccgaggttatt
ctagcgcttggcgcgaccattgatggccagaccaccgcgcattacatcgctgaccacctc
agcggcatcatcgtcagcacccttgcccaaggcgtgcccatcggcggcgagctggattat
ctggacgatggcacgattggcgccgcactgcgggcgcgacgccaattgtaa

DBGET integrated database retrieval system