KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0427Help
Entry
KVU_0427          CDS       T01909                                 

Gene name
cycM
Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:kvl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    KVU_0427 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KVU_0427 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473814..474323
Genome map
AA seq 169 aa AA seqDB search
MFGTKTRAAAALMLSIIAALALLLVIRFIADAVYSVGAIHDEPAYFVEVPGAGPRIDPLD
PVEFARIFEAADPVRGESLWRSCRMCHSLEAGDNRTGPSLAGVVGRAVDTAPGFAYSGAL
ERVVTVWTPDRINALIANPRRFAPGTLMTYTGMRNAQDRADLIAFLQGH
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcacaaaaacccgcgcagccgcggcgctgatgctgtcgatcatcgcggcgctc
gcgctgctgctggtcatccgtttcatcgcagatgcggtctattcggtcggcgcaatccat
gacgagcctgcgtattttgttgaggttccgggggcggggccgcggatcgatccgcttgat
cccgttgaattcgcccgcatctttgaggcggctgatccggtgcgcggcgaaagcctgtgg
cggtcgtgccgcatgtgccattcgctagaggcgggcgacaaccgcacaggtcccagcctt
gccggtgttgtcgggcgcgcggtcgataccgcccccggttttgcctattccggcgcgctg
gagcgggttgtcacggtttggacacctgaccgcattaatgccctgattgcgaacccgcgc
cggttcgcgccgggcacgctgatgacctataccgggatgcgaaatgcgcaggaccgcgcc
gatctgattgccttccttcaggggcactag

DBGET integrated database retrieval system