KEGG   Ketogulonigenium vulgarum: KVU_0427Help
Entry
KVU_0427          CDS       T01909                                 

Gene name
cycM
Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
kvl  Ketogulonigenium vulgarum
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:kvl00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:kvl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473814..474323
Genome map
AA seq 169 aa AA seqDB search
MFGTKTRAAAALMLSIIAALALLLVIRFIADAVYSVGAIHDEPAYFVEVPGAGPRIDPLD
PVEFARIFEAADPVRGESLWRSCRMCHSLEAGDNRTGPSLAGVVGRAVDTAPGFAYSGAL
ERVVTVWTPDRINALIANPRRFAPGTLMTYTGMRNAQDRADLIAFLQGH
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcacaaaaacccgcgcagccgcggcgctgatgctgtcgatcatcgcggcgctc
gcgctgctgctggtcatccgtttcatcgcagatgcggtctattcggtcggcgcaatccat
gacgagcctgcgtattttgttgaggttccgggggcggggccgcggatcgatccgcttgat
cccgttgaattcgcccgcatctttgaggcggctgatccggtgcgcggcgaaagcctgtgg
cggtcgtgccgcatgtgccattcgctagaggcgggcgacaaccgcacaggtcccagcctt
gccggtgttgtcgggcgcgcggtcgataccgcccccggttttgcctattccggcgcgctg
gagcgggttgtcacggtttggacacctgaccgcattaatgccctgattgcgaacccgcgc
cggttcgcgccgggcacgctgatgacctataccgggatgcgaaatgcgcaggaccgcgcc
gatctgattgccttccttcaggggcactag

DBGET integrated database retrieval system